Details for Arabidopsis Locus AT3G15160

Position : Chr3 ( 5`- 5104367 .. 5108473 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15160

Protein [Map View]
MSDQEGDWDFYLRILSNSARDSTDPASDPSILQSVKKLHGFCKMEKSDDLVARIYPQFNKVFHRSVASLSQSESGASKGL
LLLAILQFFLDFGDMVLHDSDPSLRTFFRSCLSREFSDAAVAEATCEFLVVNQRKLLASFPNLLPQFFPLLLKLIAWNWE
KLEKSFLKIFPGLISPGSFLPLFPSIVDLPILVVALEKVERSSGSGSRVGGSIASIQKSAAPEMLLALMDEAYTGSTIGD
GGDDSESEDNNTIDVADPLFLELLKDENDGLAERHRASPTLNAALQAAASGPRSERMKQTLKIAPRLLDVYFSVTLRDAN
DSLICALIPLLMTRNSTMFPDKIFSHEIRRRLLEFVLAAFQRSPNFIALLKKPIIDRLGEAYDDVAKRELALQLCWAIGE
YGGGGESHKEAARELFESLELLVYENLSSSRLGLRQESGNGSRRTTQSRLLCFVVTAIAKLATYHRELLPRARVALGKVV
KSRISDARVWRRAHDYLGLMNEPGICWSVLGPSRVSEKRFPGTVNWSEGGQKMVAHIPFHILSEQGGPPFHDFAFSDIIP
KN*

DNA
ATGAGTGATCAAGAAGGAGACTGGGATTTTTACCTCAGAATCCTAAGCAACAGCGCGCGGGATTCTACGGATCCTGCTTC
TGATCCATCTATACTACAATCAGTGAAGAAGCTGCATGGGTTCTGTAAAATGGAGAAATCAGATGATCTTGTGGCTAGAA
TTTATCCACAATTCAATAAAGTCTTCCATCGTTCGGTTGCTTCACTATCTCAGTCCGAGTCAGGGGCGTCCAAAGGCCTT
CTCTTGCTAGCCATTCTTCAGTTTTTTCTTGATTTTGGGGATATGGTTCTGCACGATTCTGACCCAAGTTTGAGGACATT
CTTCCGCTCATGTCTTAGCCGTGAGTTCTCAGATGCCGCTGTGGCAGAGGCAACTTGTGAATTCCTTGTTGTGAACCAAA
GAAAGCTCTTAGCATCTTTCCCAAACTTACTCCCTCAGTTTTTCCCGTTGTTGCTTAAGCTCATTGCCTGGAATTGGGAG
AAGTTGGAGAAGTCCTTCCTGAAGATATTTCCAGGACTGATATCACCTGGGTCATTTCTTCCTCTGTTTCCATCCATTGT
AGACTTGCCAATATTGGTCGTGGCATTAGAAAAGGTGGAAAGGAGCTCGGGGTCGGGGTCAAGGGTTGGAGGTAGCATTG
CTTCAATTCAGAAGAGTGCAGCTCCGGAGATGCTTCTTGCCCTTATGGATGAAGCATATACTGGTTCAACCATCGGGGAT
GGAGGGGATGACTCTGAATCTGAAGATAACAATACAATAGATGTAGCTGATCCTCTGTTTCTGGAGCTTCTGAAGGACGA
AAATGATGGTCTAGCGGAAAGACACCGCGCTTCTCCTACATTGAATGCAGCGCTGCAGGCTGCTGCAAGTGGTCCTCGGT
CAGAGAGGATGAAGCAGACTCTTAAGATTGCTCCCCGACTTCTTGATGTCTACTTTAGTGTTACATTGCGAGATGCAAAT
GACTCTCTGATCTGTGCTTTAATCCCTCTACTCATGACAAGAAACTCTACAATGTTTCCGGATAAGATTTTTTCTCATGA
GATCCGTAGGAGGCTACTGGAATTTGTACTAGCTGCATTTCAGAGGTCTCCAAATTTCATTGCCCTGTTGAAAAAGCCTA
TTATTGACCGACTTGGGGAAGCTTACGATGATGTTGCAAAGAGAGAGTTAGCCTTACAGCTATGTTGGGCAATTGGAGAG
TATGGTGGTGGGGGAGAATCTCACAAGGAAGCTGCTCGAGAGCTTTTTGAAAGTTTAGAGTTGCTTGTATATGAGAATCT
CTCATCAAGCCGCCTAGGTTTGAGGCAAGAATCTGGGAATGGTTCAAGAAGAACAACACAGTCAAGACTTCTGTGTTTTG
TAGTGACAGCTATCGCAAAGCTCGCAACATATCACCGAGAATTATTACCAAGAGCCCGCGTCGCCTTGGGAAAGGTAGTA
AAGTCTCGGATATCTGATGCAAGGGTTTGGAGACGAGCACATGATTACTTAGGACTAATGAACGAACCAGGAATCTGTTG
GTCTGTGTTAGGACCTTCACGGGTTTCAGAAAAACGGTTTCCAGGCACAGTTAACTGGAGCGAGGGTGGACAAAAAATGG
TTGCACACATTCCATTTCACATTCTTAGTGAACAAGGAGGTCCTCCATTCCATGACTTTGCTTTCTCCGATATCATCCCC
AAAAACTAA