Details for Arabidopsis Locus AT3G15150

Position : Chr3 ( 5`- 5101985 .. 5104140 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15150

Protein [Map View]
MASASSSDGVAGRIQNASLVLVSDNSSTLADIRKAVAMMKNIAVQLEKENQTDKVKDLENSVAELLDLHSDCNHRSTAIQ
SVANRYQPVEQLTDFKKLLDDEFTKLKATPSSVPQNDHLMRQFREAVWNVHHAGEPMPGDDDEDIVMTSTQCPLLNMTCP
LSGKPVTELADPVRSMDCRHVYEKSVILHYIVNNPNANCPVAGCRGKLQNSKVICDAMLKFEIEEMRSLNKQSNRAEVIE
DFTEDVDED*

DNA
ATGGCGTCGGCGTCCTCGTCTGACGGAGTTGCCGGAAGGATTCAGAACGCTTCTTTGGTTCTTGTCTCCGATAACAGTTC
CACGCTTGCTGATATCCGCAAAGCTGTGGCAATGATGAAGAACATTGCAGTTCAATTGGAGAAAGAAAATCAAACGGACA
AGGTTAAGGACCTTGAAAATTCTGTGGCTGAGTTATTGGATTTGCATAGTGATTGTAATCACCGTTCGACAGCAATTCAA
TCCGTTGCAAATCGGTACCAACCCGTGGAACAATTAACGGACTTTAAAAAGTTGCTTGATGATGAATTCACAAAGCTCAA
GGCTACACCTTCCTCAGTGCCACAAAATGATCATTTGATGCGCCAGTTCAGGGAAGCAGTTTGGAATGTTCATCATGCAG
GTGAACCAATGCCTGGTGACGATGATGAGGACATTGTTATGACCAGTACTCAGTGCCCTCTTCTAAACATGACATGTCCC
TTGAGCGGGAAGCCTGTCACTGAATTAGCAGATCCAGTTCGCAGTATGGATTGCAGGCACGTCTATGAAAAATCTGTAAT
CCTGCATTACATAGTCAACAATCCAAATGCGAATTGTCCTGTAGCAGGGTGCCGAGGTAAACTGCAGAATAGCAAAGTGA
TTTGTGATGCAATGTTGAAGTTTGAAATAGAGGAGATGCGCTCGTTGAACAAACAATCTAATAGGGCTGAAGTGATTGAA
GACTTCACAGAAGATGTGGATGAAGATTAG