Details for Arabidopsis Locus AT3G15140

Position : Chr3 ( 5`- 5099532 .. 5101781 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15140

Protein [Map View]
MASAFSAFRVSLSRISPFRDTRFSYPATLALAHTKRIMCNSSHSVSPSPSPSDFSSSSSSSSSSPSTFSLMETSENARWR
PMCLYYTHGKCTKMDDPAHLEIFNHDCSKELRVAAADLERKKSQEFNFFLVIDLEGKVEILEFPILIVDAKTMEVVDLFH
RFVRPTKMSEQAINKYIEGKYGELGVDRVWHDTAIPFKQVVEEFEVWLAEHDLWDKDTDWGLNDAAFVTCGNWDIKTKIP
EQCVVSNINLPPYFMEWINLKDVYLNFYGREARGMVSMMRQCGIKLMGSHHLGIDDTKNITRVVQRMLSEGAVLKLTARR
SKSNMRNVEFLFKNRIK*

DNA
ATGGCGTCCGCATTCTCTGCATTTAGGGTTTCGTTGTCCAGAATCAGTCCTTTCCGTGATACCCGGTTCTCTTATCCCGC
CACGTTGGCTTTAGCTCATACCAAACGAATCATGTGCAACTCTTCGCATTCTGTATCTCCATCTCCTTCTCCCTCTGACT
TTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTCCTTCTACTTTTTCGTTAATGGAAACAAGTGAAAATGCAAGGTGGAGA
CCCATGTGCTTGTATTACACCCACGGAAAGTGTACAAAGATGGATGATCCTGCCCATTTGGAGATTTTTAACCACGATTG
TTCAAAGGAACTTCGAGTGGCTGCTGCTGATCTTGAGAGAAAGAAGTCACAAGAATTCAATTTTTTCTTGGTTATTGACT
TGGAAGGAAAAGTTGAGATTCTTGAGTTTCCTATTTTGATCGTAGATGCCAAAACCATGGAAGTCGTAGACTTATTCCAC
AGGTTTGTAAGACCCACCAAAATGAGCGAGCAAGCAATTAACAAATACATCGAAGGCAAGTATGGGGAACTCGGGGTTGA
TCGTGTGTGGCATGACACAGCTATTCCATTTAAGCAAGTTGTTGAGGAGTTTGAAGTTTGGTTAGCTGAGCATGACTTGT
GGGATAAAGATACAGATTGGGGTCTGAACGATGCAGCTTTTGTAACCTGTGGAAACTGGGATATAAAGACAAAGATTCCT
GAGCAATGCGTAGTTTCAAACATCAATCTTCCGCCATATTTTATGGAGTGGATCAATCTCAAAGACGTCTACTTGAATTT
CTATGGCCGTGAGGCAAGAGGAATGGTGTCAATGATGAGGCAGTGTGGAATAAAACTCATGGGAAGCCACCATCTGGGCA
TTGATGACACAAAGAACATCACGAGGGTGGTGCAACGGATGCTCTCAGAAGGTGCAGTTCTCAAGCTCACAGCTCGAAGG
AGCAAATCCAATATGAGAAACGTCGAGTTTCTCTTCAAGAACAGGATCAAGTAA