Details for Arabidopsis Locus AT3G15120

Position : Chr3 ( 5`- 5088366 .. 5095482 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15120

Protein [Map View]
MKSSHEVTKNHSGSPSGKKSKKLAAICEEEYKKNHGESQDRDGGSGLACADSELRRSSRVRKIPSILDASPPPPKKRQRF
NKSSSSIEKGKRNEDGDSDAPDGWKSRLRSRRKKNVGFQASGRQRRVVKGKRKLVFRNRACELSEKAEASDREEEKGALK
GGKLNKAKKPVDVKESESSEDGGKESDTSNSEDVQKESDTSNSEDESASESEESMQADSAAREKYQEKKATKRSVFLESE
NEAEVDRTETESEDGTDSTDNEIDDSDEEGESETQCSAEKTGSETEANVEEMRADTNVTMEAVQNESRNQMEELENEIEM
GVEDEKKEMSVIVSESGNGTGIREDENKEMDVIVSESGNGTGILEGENKKMEVMVSGSGNGTGIREDDSDFAAKVKNREG
DTLHPELLGEASTEINESLKQNDDIGEQGVSRTPSNNKTKEHNEFLDRGGESVEMPDELPIQNETCKKAVDSVSTSSDRL
GKPLFKQTRRCGLCGVGTDGKLPKKLMQDNGDSDVEAPSGSSSSEEQKYDILDGFGDDPGWLGRLLGPINDRYGISGTWV
HQNCAVWSPEVYFAGVGCLKNIRAALFRGRSLKCTRCDRPGATTGCRPCARANGCIFDHRKFLIACTDHRHHFQPHGRQC
QVRMTKMKTKRMRLEMKKHSNDAWRKDVEAEEKWFEKCGEDEEFLKRESKRLHRDLLRVAPEYIGGSDSESGKAFEGWDS
VAGLEGVTQCMKEVVLIPLLYPEFFDNLGLTPPRGILLHGHPGTGKTLVVRALIGSLARGNRRIAYFARKGADCLGKYVG
DAERQLRLLFQVAEKCQPSIIFFDEIDGLAPKRSRQQDQTHSSVVSTLLALLDGLKSRGSVVVIGATNYPDAIDPALRRP
GRFDREIYFPLPSVDDRAAIISLHTRKWPKPVSGYLLKWIAKETAGFAGADIQALCTQAAMIALNRSFPLQESLAAAELG
VSSSNRAALPSFSVEERDWLEALSRSPPPCSRRGAGIAASDIFSSPLPTYLVPSLLPPLCSLLVALHLDERIFLPPLLSK
AAVDVQNVIRSALSDKKITEGCWWSHVDTLLHEVDVVKDIVQRLSCTGILDGGCDLVGSVASIPGTGDCSLGSAKFMVPR
VCRHPGVLGNASVESTSKSGFQLLIAGGPKSGQRHLASCVLHCFIGNAEMLKIDTATISQEGNGDLVLGVTHLLIKCASK
KSCVVFMPRVDLWAVKTETPLNEEVECDDDSVQENCSEMGEEKALQNGVRVSHAWNTFFEQVETLRVSTKMMILATSGMP
YKLLPPKIQQFFKTDLSKECQPTMSEAVPQFNVQVVESSDQDIAIDLSATELLRRAIQVFLHLVHQGSHTHCGLKKKYKG
EDLDQGCRDAAPQNNTDHRAGEEAVVKSKRLDDGSLKVPPLPININVKPKSSLQLAVSTFGYQILQYPQFAELCWVTSKL
KEGPSADVSGPWRGWPFNSCITRPCNSSEQTITSSDSNNVKGKDSTGIVRGLTAVGLSAYRGTYISLREVSFEVRKVLEL
LVGRISVKINAGKDRCRYIRILSQVAYLEDLVNSWVYAMRSFESTTQTESTNPLPCSVVNPSVRNEPTEQGTSDQLKGSE
EDLKEDTQNMNCPDPIASSNLTDNHQPVVEIANGHNGTNHESFLEDTGHLTTHSTDGLTLVKENVDVISDTEMMIEDSGV
NPFRQAVLLDLNSPAADHEQNETPHGSCEVETTGTVISLQEKADSLDNPNGSGDSNSISLEDPHKSADSNNGKAWDGVHG
LESANNMPEPVEQVETTGRTNPQDDPSLVCLYRCCSQCVSILQDSMHKLVTRELRLGRSSITTEGIHDAVSSLSVELISA
VRKFISVKNNGTMQEAKVKDHEECPENEACFCKRLSGNFLASVECCSHSAEMQGSLDEGNTYRRPKTWLEPVFVFKDGIL
VPVSTEDDRSLHCKYDSFCLGSLIELIATEMKPF*

DNA
ATGAAATCATCGCATGAGGTTACAAAGAATCATTCGGGTTCTCCTTCTGGGAAGAAAAGTAAGAAGCTTGCTGCAATATG
TGAGGAGGAATACAAGAAAAATCATGGAGAGTCCCAGGACAGAGATGGTGGGTCTGGGTTAGCTTGTGCTGACTCTGAAC
TTCGGCGGAGCTCTAGGGTCAGGAAGATTCCGTCCATCCTGGATGCTTCTCCTCCGCCACCAAAGAAAAGGCAGCGTTTT
AATAAGAGTTCCAGTAGTATAGAGAAAGGGAAGAGAAATGAGGATGGAGATTCGGATGCCCCGGATGGTTGGAAATCCAG
GTTGAGGTCAAGGAGGAAGAAGAACGTTGGTTTCCAAGCGAGTGGGAGACAGAGACGTGTGGTAAAGGGGAAAAGGAAGC
TCGTTTTCAGAAACCGTGCCTGTGAGTTGAGTGAAAAAGCAGAGGCAAGTGACAGGGAAGAGGAAAAAGGAGCCCTTAAA
GGTGGGAAGCTGAATAAAGCAAAAAAGCCAGTGGATGTTAAGGAATCAGAAAGTTCGGAAGATGGGGGAAAAGAGTCTGA
TACCAGTAATTCGGAAGATGTGCAAAAGGAGTCTGATACCAGTAATTCGGAAGATGAGAGTGCTAGCGAGTCAGAGGAAT
CAATGCAGGCTGACAGTGCAGCTAGAGAGAAATACCAGGAGAAGAAGGCTACCAAAAGATCCGTTTTTTTAGAGAGTGAG
AATGAAGCTGAAGTTGATAGAACGGAGACTGAGAGCGAGGATGGAACAGACAGCACTGACAATGAGATTGATGATAGTGA
TGAAGAGGGGGAAAGTGAGACACAATGTAGTGCAGAGAAGACAGGAAGTGAGACTGAAGCTAATGTGGAGGAAATGAGAG
CTGATACTAATGTTACAATGGAAGCAGTACAAAATGAAAGTCGGAATCAAATGGAAGAATTGGAAAATGAGATTGAGATG
GGAGTTGAAGATGAGAAGAAGGAGATGAGTGTGATTGTTTCGGAAAGTGGAAATGGCACTGGTATACGAGAAGATGAGAA
TAAGGAGATGGATGTAATTGTTTCGGAAAGTGGAAATGGCACTGGTATACTAGAAGGTGAGAATAAGAAGATGGAAGTAA
TGGTTTCGGGGAGTGGAAATGGCACTGGTATACGAGAAGATGATAGTGATTTTGCTGCTAAAGTTAAGAACAGAGAAGGA
GATACTTTACATCCTGAACTACTTGGCGAAGCTAGCACCGAGATTAATGAGAGTTTGAAGCAGAATGATGATATCGGAGA
GCAAGGTGTTTCTAGAACACCATCTAATAATAAGACCAAGGAACATAATGAGTTTCTTGATAGAGGGGGTGAAAGTGTGG
AAATGCCTGACGAGTTACCTATTCAGAATGAAACGTGCAAGAAGGCAGTTGACTCAGTTTCCACTTCATCAGATAGACTA
GGTAAACCTCTCTTCAAACAAACCAGACGCTGTGGTTTATGTGGAGTGGGTACTGATGGCAAACTTCCGAAGAAGTTGAT
GCAAGATAATGGTGACAGTGACGTAGAGGCACCTAGCGGGTCTTCATCTTCAGAGGAGCAAAAGTATGACATATTGGATG
GTTTTGGGGATGATCCTGGATGGCTTGGCCGTCTCTTGGGCCCTATAAACGATCGTTATGGAATTTCTGGAACTTGGGTT
CATCAGAACTGTGCCGTATGGAGTCCCGAGGTTTATTTTGCTGGTGTAGGATGCTTAAAGAATATAAGGGCAGCACTTTT
CAGAGGGAGGTCATTAAAATGCACTCGCTGTGATAGACCTGGGGCAACCACTGGCTGTCGGCCTTGTGCACGAGCTAATG
GTTGCATCTTTGATCACCGTAAATTTCTCATTGCTTGCACAGACCATAGACATCATTTCCAACCCCATGGTCGCCAATGT
CAAGTCAGAATGACGAAGATGAAAACCAAGAGGATGCGATTGGAGATGAAGAAGCACTCAAATGATGCCTGGCGCAAGGA
TGTGGAAGCGGAAGAAAAGTGGTTTGAGAAATGTGGTGAAGATGAAGAATTTTTAAAACGTGAAAGCAAGAGACTGCATC
GAGATCTATTAAGAGTTGCTCCTGAGTATATTGGAGGTTCTGATTCTGAGAGTGGAAAGGCATTTGAGGGATGGGACTCT
GTTGCTGGGCTTGAAGGTGTAACTCAATGTATGAAAGAGGTTGTTCTTATACCCTTACTATATCCAGAATTCTTTGATAA
CCTTGGACTTACACCTCCAAGAGGCATCCTCTTACATGGACATCCTGGAACTGGGAAAACTCTTGTGGTTCGAGCGCTGA
TCGGTTCCCTTGCTCGTGGGAATAGACGGATTGCCTACTTTGCTCGCAAAGGGGCAGACTGTTTGGGAAAATATGTTGGT
GATGCTGAGCGCCAGTTGAGGCTCTTGTTTCAGGTCGCTGAAAAATGCCAACCATCCATCATATTTTTTGATGAAATAGA
TGGTCTCGCTCCAAAGCGGTCAAGGCAGCAAGATCAAACTCATAGCTCCGTTGTATCCACATTACTGGCTTTACTAGATG
GCTTAAAGTCACGTGGCTCAGTGGTGGTCATAGGTGCAACCAACTACCCTGATGCTATTGACCCAGCATTAAGGAGGCCT
GGGAGGTTTGATAGGGAGATCTATTTTCCACTACCATCAGTCGACGATAGGGCTGCAATCATCTCACTCCACACTAGGAA
ATGGCCTAAGCCGGTGTCTGGATACTTGCTCAAGTGGATTGCTAAAGAAACTGCCGGTTTTGCTGGTGCTGATATACAAG
CTCTCTGCACACAAGCTGCCATGATTGCCTTAAATAGGAGTTTCCCTTTACAAGAATCTTTGGCCGCTGCAGAGTTGGGA
GTGTCTAGCAGTAATCGTGCTGCTCTTCCATCCTTCTCAGTTGAAGAAAGAGATTGGTTGGAAGCTTTATCCCGCTCTCC
ACCCCCATGTTCACGTAGAGGAGCAGGAATAGCAGCTAGTGATATATTTTCTTCTCCGCTTCCTACTTACTTGGTACCTT
CTTTATTGCCGCCATTATGTTCTTTACTTGTTGCTCTTCATCTTGATGAACGTATCTTCCTACCACCTCTTCTTTCCAAA
GCTGCGGTTGATGTCCAAAATGTGATCCGTTCTGCTTTGAGCGACAAGAAGATAACTGAGGGTTGTTGGTGGTCTCATGT
TGATACCCTTCTCCATGAAGTAGATGTTGTAAAGGATATAGTACAAAGACTTTCTTGTACTGGGATACTGGATGGAGGAT
GTGACTTGGTTGGATCTGTTGCAAGCATTCCTGGTACTGGCGACTGTAGTTTGGGTTCTGCAAAATTCATGGTACCTAGA
GTCTGCAGACATCCTGGGGTTTTGGGGAATGCCTCTGTAGAATCAACGAGCAAGTCAGGGTTCCAACTACTTATTGCTGG
AGGACCTAAATCTGGTCAACGACATCTTGCTTCTTGTGTCTTGCATTGTTTTATTGGTAATGCAGAGATGCTAAAGATAG
ACACAGCAACAATTTCACAAGAAGGAAATGGGGATCTGGTGCTAGGTGTAACTCACTTATTAATTAAATGTGCTAGCAAG
AAATCATGTGTGGTATTCATGCCAAGGGTTGACTTGTGGGCTGTAAAGACAGAAACTCCTCTGAATGAAGAGGTCGAGTG
TGATGATGATTCTGTACAGGAAAATTGTTCAGAAATGGGAGAGGAAAAGGCATTGCAGAATGGTGTTCGAGTTTCACATG
CTTGGAACACATTTTTTGAGCAAGTAGAAACGCTGCGAGTTTCCACAAAGATGATGATTCTGGCTACTTCTGGCATGCCC
TACAAACTCCTGCCTCCTAAGATACAACAGTTCTTTAAGACTGACCTATCAAAGGAGTGTCAGCCAACTATGTCTGAGGC
TGTTCCACAATTCAATGTACAAGTTGTTGAAAGTTCTGACCAGGATATAGCCATTGACCTGTCTGCTACTGAGTTGTTAA
GGCGGGCAATCCAAGTATTTCTTCATTTGGTGCATCAGGGATCCCATACTCACTGTGGCTTAAAGAAGAAATACAAAGGA
GAGGATCTTGACCAGGGTTGCAGAGATGCAGCTCCTCAGAATAATACTGATCACAGAGCAGGGGAAGAAGCAGTTGTTAA
ATCAAAACGTCTTGATGATGGTTCTTTAAAAGTTCCACCATTACCTATCAACATCAATGTGAAACCAAAATCAAGCCTGC
AGTTAGCTGTCTCCACATTTGGTTATCAAATACTACAGTATCCTCAATTTGCTGAACTTTGCTGGGTGACATCAAAGCTT
AAGGAAGGGCCAAGTGCAGATGTTTCTGGTCCTTGGAGGGGATGGCCATTTAATTCGTGTATCACTCGCCCTTGTAATTC
CTCGGAGCAGACTATTACTTCTTCCGATTCCAACAATGTTAAAGGAAAAGATTCCACTGGAATTGTCAGAGGTCTTACTG
CTGTTGGATTATCAGCGTATAGAGGAACCTATATATCGCTGAGGGAAGTCTCATTTGAGGTACGGAAAGTTCTGGAGCTC
TTAGTTGGACGGATCAGTGTTAAAATTAATGCTGGAAAGGACAGATGTCGATATATTCGAATTTTGTCTCAAGTTGCTTA
TCTGGAAGATCTGGTTAATAGTTGGGTATACGCGATGCGAAGTTTCGAATCAACCACTCAAACAGAGTCAACGAATCCAT
TACCTTGTTCTGTAGTCAATCCATCAGTGAGGAATGAGCCAACTGAGCAAGGAACATCTGATCAATTAAAAGGGTCAGAA
GAAGACCTGAAAGAAGATACCCAAAACATGAATTGTCCAGACCCTATAGCATCTAGTAATCTTACCGACAATCATCAGCC
AGTTGTAGAGATTGCAAATGGTCATAATGGAACAAATCATGAATCTTTTCTTGAAGATACTGGACATCTTACAACCCACA
GTACGGATGGCTTAACTTTGGTCAAAGAGAATGTTGATGTTATTTCAGATACTGAAATGATGATTGAGGATTCAGGAGTG
AATCCCTTTCGGCAGGCTGTTCTCCTTGATCTTAACTCTCCTGCAGCTGACCATGAACAGAATGAAACTCCACATGGATC
ATGCGAGGTAGAAACTACAGGAACAGTAATTTCTTTGCAAGAAAAAGCTGATTCCCTAGACAATCCTAATGGATCTGGGG
ATTCCAATTCTATATCCCTGGAAGATCCCCACAAATCAGCTGACTCAAATAACGGTAAAGCCTGGGATGGAGTTCATGGA
TTAGAATCCGCAAACAACATGCCTGAACCAGTTGAACAAGTTGAAACGACTGGAAGAACCAATCCTCAGGATGACCCTAG
CTTGGTGTGCTTGTACCGTTGCTGCTCCCAGTGCGTCTCCATCCTCCAAGATTCAATGCATAAATTAGTTACTCGCGAAT
TGAGACTTGGTAGGAGTTCCATCACAACAGAGGGTATACATGATGCGGTTTCTTCATTATCAGTGGAGCTTATTTCTGCT
GTTAGAAAGTTCATCTCTGTGAAAAACAATGGTACCATGCAGGAAGCGAAGGTCAAAGATCATGAGGAATGTCCAGAAAA
CGAAGCATGTTTTTGCAAACGCTTATCCGGTAATTTTCTTGCCTCTGTCGAATGTTGCAGTCATTCTGCTGAAATGCAAG
GGAGCTTAGATGAGGGAAATACATATCGAAGACCTAAGACTTGGCTTGAACCAGTATTCGTTTTCAAAGATGGAATATTG
GTTCCGGTGAGTACTGAAGATGACCGCTCTTTGCATTGTAAATATGATAGTTTCTGCCTTGGTTCTCTCATAGAGTTAAT
TGCAACTGAGATGAAGCCTTTTTGA