Details for Arabidopsis Locus AT3G15115

Position : Chr3 ( 5`- 5085992 .. 5087489 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15115

Protein [Map View]
MDSTSNDHQELEQFEAIDDLLEDFWFFDNLLDRRSRILRYCHSDPYPFTSSSSSTCPKPELPKIGDSDSEIKLLEASTGG
DFVPPPCIEKKEGGGEPEKINKVMRRQFSEKTRVQERRTYLQKKEPVVREKGIKEGSRKKNRTRISCSNNNSVQSCSMGG
SLQRTQTLPSYLGREDDVNEFQDQEIDDSRMGFLIREAIANSSSSSSSGFTPTKQNIPKVSCIPRHRPPRNSRSEDAIQE
LVVKSQKSPNRKTLRKTLSSIETKDIQMLKDFHIETEKKQEEDEEKQRKVPCTTTGKNRSTAVVGQPIPVWVPKDSRKDM
KAQIKFWARTVASNVRQEC*

DNA
ATGGATTCTACTTCGAATGATCATCAAGAGTTGGAACAATTCGAAGCCATTGATGATCTCCTCGAAGATTTCTGGTTCTT
TGATAACTTACTTGACAGAAGATCAAGGATCTTGAGGTACTGTCATTCAGATCCTTACCCTTTTACTTCTTCTTCTTCTT
CAACTTGTCCCAAACCCGAATTACCGAAAATTGGAGATTCGGATTCGGAGATTAAGCTTCTAGAAGCTTCTACTGGGGGA
GACTTTGTTCCGCCGCCGTGTATAGAGAAAAAAGAAGGCGGAGGCGAGCCTGAGAAGATAAATAAGGTGATGAGAAGGCA
GTTCTCTGAGAAGACTAGGGTTCAAGAACGAAGAACTTACTTGCAAAAGAAGGAACCTGTAGTTCGAGAGAAGGGAATTA
AAGAAGGTTCGAGGAAGAAGAACAGAACAAGAATTAGTTGTAGTAACAATAATAGTGTCCAGAGTTGCTCGATGGGAGGG
AGTTTGCAGAGAACTCAGACTTTGCCTAGTTACTTAGGAAGAGAAGACGATGTAAATGAGTTTCAAGATCAAGAGATTGA
TGATTCAAGAATGGGATTTTTGATCCGTGAAGCCATCGCTAACTCTTCTTCTTCTTCTTCTTCTGGATTTACTCCAACGA
AACAGAACATTCCAAAGGTTTCATGCATTCCAAGGCATAGACCACCTAGAAACTCAAGATCAGAAGACGCTATTCAAGAA
TTGGTCGTCAAATCACAAAAAAGCCCAAACCGCAAAACGCTGCGTAAAACGTTAAGCAGCATCGAGACGAAAGATATTCA
AATGTTGAAGGATTTTCACATTGAAACAGAGAAGAAGCAAGAAGAAGACGAAGAAAAACAGAGGAAGGTCCCATGCACCA
CCACTGGGAAAAACCGGTCTACAGCGGTGGTGGGACAGCCGATTCCGGTTTGGGTTCCAAAGGATTCGAGAAAAGACATG
AAAGCTCAGATAAAGTTTTGGGCTCGAACCGTCGCAAGTAATGTTCGACAAGAATGCTGA