Details for Arabidopsis Locus AT3G15110

Position : Chr3 ( 5`- 5084278 .. 5085843 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15110

Protein [Map View]
MLVLQSHQCLFSLPYRLRPTRLISPIHSLSSFTRIRPGIIRLSAVKEIADVAEVEEDGPIELPTSSTSPFSSTNSIFATS
DDPTPLQLATSVLLTGAITVFLIRSVRRRAKRAKELTFRSTGAKKSLKEEAMDNLKALSSTPIEGGNSTPSAAQAFLGAI
AAGVIALILYKFTVTVESGLNRQTISDNFSVRQITVTVRTIINGICYLATFVFGLNAFGLLLYSGQLAFNEDSAEENMKA
TTQPGDSSSGDNSEVNKSNEDQSSGD*

DNA
ATGTTAGTGTTGCAGAGCCACCAATGTCTCTTCTCTCTCCCTTACCGTCTCCGTCCAACGCGTCTTATCTCTCCAATCCA
TTCGCTCTCTTCCTTTACCAGGATCCGTCCCGGTATAATCCGATTATCCGCCGTAAAAGAAATCGCCGATGTGGCGGAGG
TGGAAGAAGATGGTCCAATTGAGCTTCCTACGTCGTCCACGTCTCCGTTTTCGTCTACTAACTCCATTTTCGCCACTTCC
GATGATCCTACTCCTCTCCAATTGGCCACCAGTGTGCTTCTTACCGGTGCCATCACTGTCTTCCTCATCCGCTCCGTTCG
ACGGCGCGCTAAACGCGCCAAAGAGCTGACATTTAGATCTACTGGAGCTAAGAAATCGTTGAAAGAAGAAGCAATGGATA
ATCTAAAAGCGTTAAGTTCAACTCCGATAGAAGGTGGTAATTCAACTCCATCGGCGGCTCAGGCGTTTCTTGGTGCGATA
GCCGCAGGAGTCATTGCTCTCATTCTTTACAAATTCACTGTTACAGTTGAATCAGGACTCAATCGTCAGACTATCTCTGA
TAACTTCTCGGTTAGGCAAATCACGGTAACCGTAAGGACTATCATCAACGGTATATGCTATCTAGCAACATTTGTTTTCG
GTCTCAACGCGTTCGGACTTCTCCTTTACTCTGGTCAATTAGCCTTCAATGAAGATTCTGCTGAAGAAAACATGAAGGCC
ACAACACAACCTGGAGACTCATCATCAGGTGACAACAGTGAAGTAAATAAAAGCAATGAGGATCAAAGTTCAGGTGATTG
A