Details for Arabidopsis Locus AT3G15095

Position : Chr3 ( 5`- 5081780 .. 5084240 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15095

Protein [Map View]
MAETERPHRSSSINSSSNNNSGSSTDLFICFTSRFSSSSSMRLSSKSIHSPARSACLTTSLSRRLRTSGSLKNASAGVLN
SPMFGANGGRKRSGSGYENSNNNNNNNIEPSSPKVTCIGQVRVKTRKHVKKKMRARSRRKGGENSFRRSVDQNDGGGGCR
FKASENRLVHLPVTICESLRSFGSELNCFFPCRSSCTENSHGDGRRAESNNDGCGGGGGGSNSCGAVFTRWFVAVEETSG
GKRREIELVVGGEDEVEEDRRRSRRRHVFEGLDLSEIEMKTEKKERGEEVGRMSICSPPKNALLLMRCRSDPVKVAALAN
RVRERQLSLNDGVYTEEEEDERRRRFELEIEDKKRIDLCEKWISGETTVETEEVSVAVAEAEAEAEAEAPLPSNPATEEE
ERVKVVEDSIVEEEQEASKILDSFEEEIEATIMKKIEDEIRNAIEEEEKLAEMEELAVVAVAETEEVEESKEVVPDCIPQ
NEERSEQGNREPDPSPEVVMRRSLQEETTEKEKTTATPYKVLPDCLLLMMCEPKLSMEVSKETWVCSTDFVRCLPGRPPA
KKIPPEAVGDNHHHHQPKKRIVTAVDSNASSRRRSIDRPPLHLQPPRSSCSYPAAPPIITAAAAVGEQRVAGANKVQPPV
LPRCKSEPRKSASKLAPEACFWKNRKLEPHPPATVGVGGAGVGF*

DNA
ATGGCGGAAACTGAGAGACCCCACCGGTCTTCAAGTATTAACAGTAGTAGCAACAACAACAGTGGTTCATCAACCGATCT
ATTCATTTGTTTCACATCTCGTTTCTCTTCTTCTTCCTCTATGCGTCTCTCTTCTAAATCCATCCATAGCCCAGCTCGTT
CCGCTTGTCTCACCACTTCTCTTAGCCGTCGTCTCCGTACTAGCGGTAGCTTGAAGAACGCTTCAGCTGGAGTTTTGAAC
TCTCCCATGTTTGGTGCTAATGGAGGACGGAAGAGATCTGGATCTGGCTACGAGAATAGTAACAACAACAACAATAATAA
CATAGAGCCGTCGTCTCCGAAGGTGACGTGTATTGGTCAAGTTAGAGTGAAGACTAGGAAGCATGTGAAGAAGAAGATGA
GAGCTAGATCTAGAAGGAAAGGAGGTGAGAATAGTTTCAGGAGATCCGTTGATCAAAACGACGGTGGTGGTGGATGTCGT
TTTAAAGCGAGTGAGAATCGTTTGGTGCATCTTCCGGTGACTATCTGCGAGTCGTTGAGATCGTTTGGGTCTGAGCTCAA
CTGCTTCTTCCCGTGTCGATCTTCCTGTACGGAGAATAGTCATGGAGATGGGAGGAGAGCTGAGAGTAACAACGACGGTT
GCGGCGGCGGCGGAGGAGGAAGTAATTCGTGTGGTGCGGTGTTTACGAGGTGGTTTGTGGCGGTGGAGGAGACTTCGGGA
GGGAAGAGAAGAGAGATTGAGCTTGTTGTTGGTGGAGAAGACGAAGTTGAGGAGGATAGGCGGAGGAGTCGTCGGAGACA
TGTTTTCGAGGGGCTTGATTTAAGTGAGATAGAGATGAAGACGGAGAAGAAAGAGAGAGGAGAAGAAGTTGGACGGATGA
GTATTTGTTCTCCGCCGAAGAATGCTTTGTTGTTGATGCGGTGTAGATCTGATCCGGTTAAGGTTGCGGCGTTAGCTAAC
CGGGTTCGTGAAAGACAGTTGTCGTTAAACGACGGCGTATACACAGAGGAGGAAGAAGATGAGAGAAGAAGAAGGTTTGA
GCTGGAAATTGAAGATAAGAAACGGATCGACTTGTGTGAGAAATGGATCTCTGGTGAGACTACTGTGGAAACAGAAGAAG
TTTCAGTAGCAGTTGCAGAAGCAGAAGCAGAAGCAGAAGCAGAAGCTCCTTTGCCTTCAAATCCAGCTACAGAGGAAGAA
GAAAGAGTCAAAGTTGTGGAAGATTCGATTGTTGAAGAAGAACAAGAAGCTTCGAAAATTCTGGATTCGTTTGAGGAAGA
AATAGAAGCTACGATCATGAAAAAAATTGAAGACGAAATCAGAAACGCTATAGAAGAAGAGGAGAAACTTGCTGAGATGG
AAGAATTAGCGGTTGTGGCGGTGGCTGAGACGGAGGAGGTAGAAGAAAGCAAAGAGGTTGTTCCTGATTGTATACCTCAA
AATGAGGAAAGATCCGAACAAGGAAACCGGGAACCCGACCCGAGTCCGGAAGTGGTGATGAGAAGAAGTCTACAAGAGGA
AACAACGGAGAAAGAGAAGACGACGGCGACGCCGTATAAGGTGTTACCGGATTGTTTGCTGCTTATGATGTGTGAACCAA
AGCTCTCAATGGAAGTCTCTAAGGAGACTTGGGTTTGCAGTACAGATTTCGTCAGATGTTTACCAGGAAGACCTCCGGCG
AAGAAGATACCACCAGAAGCCGTCGGAGACAATCATCATCATCATCAACCCAAGAAGCGAATCGTCACAGCCGTTGATTC
CAACGCATCCTCTCGCCGGCGGTCAATCGATAGACCACCACTTCACCTACAGCCGCCACGGTCATCGTGTTCATACCCAG
CAGCTCCACCGATAATAACGGCAGCTGCGGCGGTTGGGGAACAGAGGGTAGCCGGAGCTAATAAGGTACAGCCACCAGTG
CTGCCACGTTGCAAATCGGAACCGAGGAAGTCAGCGTCGAAGCTAGCGCCGGAAGCTTGTTTCTGGAAAAATAGGAAGCT
TGAGCCACACCCTCCGGCAACCGTCGGTGTCGGCGGCGCCGGAGTAGGGTTCTAG