Details for Arabidopsis Locus AT3G15070

Position : Chr3 ( 5`- 5070134 .. 5073356 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15070

Protein [Map View]
MRQRNMMTGSDMEQNSQSFVPHPEPRIGTNYLYPDIPPVNTVPHLEAHSLQEPYDNNSMFYGPPQYHHQHASNLGSGMST
APNFYVPYVNYEAPPSFLLSHGSNDAVVGVTSTEHERNAHFMDHGFKRKSSEVIPGNSQYPVAPCSFPQLNTSETAPFSF
PHFGTYPQPLDQRSVRNRAGAATMDPLLSHGHNNFSQGNYAAHPFPPLGSIWYDQHCNGNRSDGSSSLWSQAPAVPYMHG
NIATGSIESGNVCFPRYHETSSSRNPTPSVYQRNHYISHHPVPPPPIVYPHMPSASYAETLHPASYSHMGQVQSTGFRIN
QYPGEDFVPAAILRHRELPHFRAMPANENAFWEVGDFYNAVNYVDHHQDMRLDIEDMSYEELLALSDQIGTVKTGLSSED
VKELLKRRTSTRINLEEGPSTDLETDSCTICQENYKNEDKIATLDCMHKYHAECLKKWLVIKNVCPICKSEALVIEKKKK
LRLSSR*

DNA
ATGCGACAAAGAAATATGATGACTGGTTCAGACATGGAGCAGAATTCTCAAAGCTTTGTTCCCCATCCTGAACCTCGCAT
TGGAACTAACTATCTGTATCCAGATATCCCACCAGTGAACACTGTTCCTCATTTAGAAGCTCATTCTCTGCAAGAACCTT
ATGATAACAACTCAATGTTCTACGGGCCTCCACAGTACCATCATCAACATGCTTCAAATCTTGGTTCTGGCATGTCAACC
GCACCAAATTTCTATGTCCCTTATGTGAATTATGAAGCTCCACCGAGTTTTCTGTTGTCTCATGGAAGTAATGATGCAGT
TGTTGGAGTTACTTCCACTGAACATGAGAGAAATGCCCATTTTATGGATCACGGATTCAAAAGAAAGAGTTCTGAAGTAA
TACCTGGAAATTCTCAGTATCCAGTTGCTCCTTGTTCTTTCCCTCAATTGAATACATCGGAGACAGCACCTTTTTCATTC
CCACATTTTGGTACTTATCCACAACCACTAGATCAGAGAAGTGTGAGGAACAGAGCAGGAGCAGCTACAATGGATCCACT
TCTCTCTCATGGTCATAACAACTTCAGTCAAGGAAACTATGCAGCTCATCCTTTTCCACCTCTTGGCTCAATCTGGTATG
ACCAACACTGTAATGGCAACAGATCTGATGGATCATCTTCGCTTTGGTCTCAAGCACCTGCCGTACCTTATATGCATGGT
AACATTGCTACTGGATCTATAGAATCTGGTAATGTTTGCTTCCCAAGATACCATGAAACATCTAGTAGCAGAAACCCCAC
GCCATCTGTATACCAAAGGAACCACTATATTAGCCATCACCCCGTACCTCCTCCTCCCATCGTATACCCTCACATGCCTT
CAGCCTCATACGCTGAGACTTTGCATCCTGCTTCATACAGTCATATGGGACAGGTTCAATCAACCGGATTCAGGATAAAC
CAATATCCCGGAGAAGATTTTGTACCTGCAGCAATTCTAAGACACCGTGAATTGCCTCACTTTAGAGCAATGCCCGCGAA
TGAAAATGCATTTTGGGAAGTAGGAGACTTCTACAATGCTGTTAATTATGTCGATCATCATCAAGACATGCGCTTAGACA
TAGAAGATATGTCATATGAGGAGCTTCTTGCTTTGAGCGACCAGATTGGAACTGTGAAGACAGGCTTGTCATCAGAAGAT
GTTAAAGAACTTCTGAAAAGAAGAACCTCGACCAGAATTAACCTGGAAGAAGGTCCATCTACTGATCTAGAGACTGATTC
TTGCACGATATGCCAGGAAAACTACAAGAACGAAGATAAGATCGCAACGCTGGATTGCATGCACAAATACCATGCAGAAT
GCTTGAAGAAGTGGTTGGTTATCAAGAACGTTTGCCCAATCTGTAAATCAGAGGCATTGGTCATAGAGAAGAAGAAGAAG
CTAAGGTTAAGTAGTAGATGA