Details for Arabidopsis Locus AT3G15050

Position : Chr3 ( 5`- 5066879 .. 5067960 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15050

Protein [Map View]
MGSGWLLRSIICLNGTKKNKSNRGNVHSETSNRVKPVESSSAASTKLTVEVAVIRIQKAFRAFKARKRLCSLKSARRFNS
LIQGHTVMNQTSTALNVIHSWYDIQNQIRARRLYMVTQGRLQHKRLENRLKLEIKLHELEVEWCGGSETMEEILAKIQQK
EEATVKRERAMAYAFSHQWRANATQYLGQASFNLGKESWGWSWKERWIAARPWEIRAQCYVVKPIKPSKKPEKSSPNNVI
TKTSAKPDEVGNSKKPGSG*

DNA
ATGGGATCTGGATGGCTGCTCCGCTCAATCATCTGTCTAAACGGAACAAAGAAGAACAAATCAAATCGAGGCAACGTACA
TTCTGAAACATCAAACCGTGTCAAACCGGTTGAATCAAGCTCTGCTGCTTCTACTAAGCTTACCGTAGAAGTCGCTGTTA
TTCGCATTCAAAAGGCTTTTCGAGCATTCAAGGCGAGAAAAAGACTATGCAGCTTGAAGAGTGCGAGGAGATTTAACTCG
CTGATCCAAGGCCATACAGTGATGAACCAAACCTCGACTGCACTCAATGTGATTCATTCTTGGTACGATATACAGAATCA
GATCAGAGCACGACGTTTGTATATGGTGACACAAGGTAGACTCCAACACAAAAGATTGGAGAATCGTTTGAAGCTGGAGA
TCAAACTTCACGAGCTAGAAGTTGAATGGTGTGGAGGCTCTGAAACAATGGAGGAGATTCTCGCAAAGATACAACAGAAA
GAAGAAGCTACGGTTAAGCGTGAAAGAGCAATGGCTTATGCTTTCTCTCATCAGTGGAGGGCTAATGCTACACAGTATCT
AGGTCAAGCTTCGTTTAACCTTGGCAAAGAAAGCTGGGGATGGAGTTGGAAAGAACGGTGGATTGCGGCTCGACCTTGGG
AGATTAGGGCTCAATGCTACGTCGTTAAACCGATCAAACCATCTAAGAAACCGGAGAAATCATCACCCAATAATGTGATC
ACAAAAACCTCTGCTAAACCGGATGAAGTTGGTAACTCGAAAAAGCCTGGTTCCGGATAA