Details for Arabidopsis Locus AT3G15040

Position : Chr3 ( 5`- 5064704 .. 5066690 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15040

Protein [Map View]
MNKNPRLDFSSPSSLATISDSADGELNEDDIFAIDISHAPPQARHSPVSSPAKQQTPARQLQRSKSGLKNVEASGILAAL
PESSGSSSYLSHVFHHKPAAALSTSVSSTASSSSSSGGGASAGSSSSARAIPTAPKPPQERLPFSASFVGGGKYPQSAPV
QVPLVSSAMMNRHKKEFKLTDVVDDDEEEEEGEMLPPHEIVARSLAQSSLLSCSVLEGAGRTLKGRDLRQVRNAVFRRTG
FID*

DNA
ATGAATAAAAATCCACGGCTCGATTTTTCCTCACCGTCGTCGTTAGCCACTATCTCCGACTCTGCAGACGGTGAGCTGAA
TGAAGACGACATCTTTGCAATCGACATATCTCACGCGCCGCCTCAAGCTCGTCATTCTCCTGTATCATCTCCGGCGAAGC
AACAAACTCCTGCTCGTCAGCTTCAGAGGAGCAAAAGCGGTTTGAAGAATGTGGAAGCGTCTGGTATCCTCGCGGCTCTT
CCTGAATCATCTGGGAGTAGTAGTTACTTAAGTCATGTCTTTCACCACAAACCTGCGGCTGCTCTCTCTACTTCTGTCTC
CTCCACAGCTTCTTCATCGTCTTCTTCAGGTGGTGGTGCATCAGCTGGTTCTTCGTCTTCAGCTCGAGCTATCCCGACCG
CGCCTAAACCGCCTCAAGAGAGGCTTCCGTTTTCAGCTTCTTTTGTAGGTGGTGGGAAGTATCCTCAATCAGCTCCGGTT
CAAGTGCCGTTAGTGTCGTCTGCGATGATGAATCGTCATAAGAAGGAATTCAAGCTGACTGATGTGGTGGATGATGATGA
GGAAGAAGAGGAAGGCGAAATGCTTCCGCCTCACGAGATTGTAGCTCGGTCTTTGGCTCAGTCGTCGTTGTTATCTTGCT
CTGTGCTTGAAGGAGCAGGAAGGACACTTAAAGGGAGAGATCTCCGGCAGGTAAGGAATGCTGTTTTCAGAAGAACCGGT
TTCATAGATTGA