Details for Arabidopsis Locus AT3G15030

Position : Chr3 ( 5`- 5061681 .. 5064115 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15030

Protein [Map View]
MSDDQFHHPPPPSSMRHRSTSDAADGGCGEIVEVQGGHIVRSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDVQDRL
GFDRPSKAVDWLIKKAKTSIDELAELPPWNPADAIRLAAANAKPRRTTAKTQISPSPPPPQQQQQQQQLQFGVGFNGGGA
EHPSNNESSFLPPSMDSDSIADTIKSFFPVIGSSTEAPSNHNLMHNYHHQHPPDLLSRTNSQNQDLRLSLQSFPDGPPSL
LHHQHHHHTSASASEPTLFYGQSNPLGFDTSSWEQQSSEFGRIQRLVAWNSGGGGGATDTGNGGGFLFAPPTPSTTSFQP
VLGQSQQLYSQRGPLQSSYSPMIRAWFDPHHHHQSISTDDLNHHHHLPPPVHQSAIPGIGFASGEFSSGFRIPARFQGQE
EEQHDGLTHKPSSASSISRH*

DNA
ATGTCTGACGACCAATTCCATCACCCGCCGCCTCCTTCTTCAATGAGGCACCGTTCTACGTCGGATGCGGCGGACGGCGG
CTGCGGCGAGATTGTTGAGGTGCAAGGTGGTCACATTGTTCGGTCTACCGGAAGAAAAGACCGCCACAGCAAAGTCTGCA
CGGCTAAAGGGCCACGTGACCGGCGCGTGAGACTCTCTGCTCACACGGCGATTCAGTTTTACGATGTTCAAGACAGGCTT
GGTTTCGACCGACCTAGCAAAGCCGTTGATTGGCTTATCAAAAAGGCTAAGACTTCCATTGACGAGCTCGCTGAGCTTCC
TCCCTGGAATCCCGCCGATGCAATTCGCCTAGCCGCTGCTAACGCTAAACCCAGAAGAACCACCGCCAAAACCCAAATCT
CTCCGTCTCCGCCACCGCCGCAACAGCAACAACAACAACAACAGCTTCAGTTCGGTGTTGGCTTCAACGGAGGAGGAGCA
GAGCATCCGAGTAACAACGAGTCGAGTTTTCTCCCGCCGTCAATGGATTCAGATTCGATAGCTGACACTATAAAGTCGTT
TTTTCCGGTGATTGGCTCTTCAACGGAGGCTCCTTCGAATCATAACCTTATGCACAACTATCATCATCAGCATCCGCCGG
ATTTGCTTTCTCGAACTAATAGCCAAAACCAAGATCTCCGTCTCTCGCTGCAATCGTTCCCGGATGGTCCACCGTCGCTT
CTGCACCACCAACATCACCACCACACCTCTGCTTCCGCCTCCGAGCCTACTCTGTTCTACGGACAGAGCAATCCGTTAGG
GTTTGACACATCGAGTTGGGAGCAGCAGTCGTCGGAATTCGGAAGGATTCAGAGACTAGTGGCTTGGAACAGCGGCGGTG
GCGGCGGAGCAACCGATACAGGAAACGGAGGAGGGTTTCTGTTCGCTCCTCCTACTCCTTCAACGACGTCGTTTCAGCCA
GTTCTTGGCCAAAGCCAACAGCTTTATTCTCAGAGGGGTCCCCTTCAGTCCAGTTACAGTCCCATGATCCGTGCTTGGTT
TGATCCTCACCATCATCACCAATCCATCTCCACCGACGATCTCAACCACCACCATCACCTTCCTCCACCGGTTCACCAAT
CAGCAATCCCCGGAATCGGATTCGCCTCAGGTGAATTCTCTTCGGGTTTTCGCATACCAGCACGGTTTCAGGGCCAAGAA
GAGGAGCAGCACGACGGTCTCACTCACAAGCCGTCCTCTGCTTCCTCTATTTCTCGCCATTGA