Details for Arabidopsis Locus AT3G15010

Position : Chr3 ( 5`- 5052731 .. 5054942 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15010

Protein [Map View]
MDMMKKRKLDENGNGLNTNGGGTIGPTRLSPQDARKIIERFTTDQLLDLLQEAIVRHPDVLESVRLTADSDISQRKLFIR
GLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKEPSKKIDGRVTVTQLAASGNQGTGSQ
IADISMRKIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCK
LAVDGKKGGKPGMPQAQDGGSGHGHVHGEGMGMVRPAGPYGAAGGISAYGGYSGGPPAHHMNSTHSSMGVGSAGYGGHYG
GYGGPGGTGVYGGLGGGYGGPGTGSGQYRMPPSSMPGGGGYPESGHYGLSSSAGYPGQHHQAVGTSPVPRVPHGGMYPNG
PPNY*

DNA
ATGGATATGATGAAGAAGCGTAAGCTCGATGAGAACGGTAACGGACTCAATACCAACGGTGGCGGAACCATTGGTCCAAC
TCGATTGTCGCCGCAAGACGCGAGGAAGATTATCGAGCGATTCACCACTGATCAGCTGCTCGACTTATTGCAAGAGGCTA
TCGTACGCCATCCCGACGTGCTTGAATCTGTCCGATTAACCGCCGACTCTGATATCTCGCAGCGGAAGCTATTCATCCGT
GGTCTCGCGGCGGATACTACTACGGAAGGTCTCCGTTCGCTTTTTTCCAGTTACGGAGATCTAGAAGAAGCTATTGTGAT
CCTTGACAAGGTCACTGGGAAATCGAAAGGGTATGGTTTCGTCACTTTTATGCACGTTGATGGAGCTTTACTAGCTCTGA
AAGAACCATCTAAGAAAATTGATGGGCGTGTTACAGTAACGCAGCTCGCGGCATCTGGAAATCAAGGTACGGGTTCCCAG
ATTGCAGATATATCAATGAGGAAGATCTATGTGGCGAATGTTCCTTTTGATATGCCGGCGGATAGGCTATTGAATCACTT
TATGGCTTATGGAGATGTTGAGGAAGGTCCTTTGGGTTTTGATAAGGTTACTGGTAAATCTAGAGGCTTTGCATTGTTTG
TCTACAAGACAGCGGAAGGTGCGCAGGCTGCTCTTGCTGATCCGGTGAAGGTGATTGATGGAAAACATTTGAATTGTAAG
TTGGCTGTTGATGGTAAGAAAGGAGGGAAGCCTGGAATGCCACAAGCTCAAGATGGTGGTTCTGGTCATGGACACGTTCA
TGGTGAGGGAATGGGAATGGTGCGTCCTGCAGGACCTTATGGTGCAGCTGGTGGTATCAGTGCTTATGGTGGGTACTCTG
GAGGACCACCAGCGCATCACATGAATTCCACACACTCCTCAATGGGTGTTGGTTCTGCTGGGTATGGTGGACACTATGGT
GGATATGGAGGTCCAGGTGGTACTGGCGTCTACGGTGGACTTGGCGGTGGGTATGGTGGGCCTGGTACTGGAAGTGGGCA
GTATAGAATGCCACCAAGTTCGATGCCTGGTGGTGGTGGTTATCCCGAGAGTGGGCATTACGGTCTTTCATCATCTGCTG
GGTATCCTGGACAGCATCATCAGGCTGTTGGAACGTCCCCTGTGCCAAGAGTTCCTCATGGCGGAATGTACCCCAACGGT
CCACCAAACTACTGA