Details for Arabidopsis Locus AT3G15000

Position : Chr3 ( 5`- 5050257 .. 5052432 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G15000

Protein [Map View]
MATHTISRSILCRPAKSLSFLFTRSFASSAPLAKSPASSLLSRSRPLVAAFSSVFRGGLVSVKGLSTQATSSSLNDPNPN
WSNRPPKETILLDGCDFEHWLVVVEPPQGEPTRDEIIDSYIKTLAQIVGSEDEARMKIYSVSTRCYYAFGALVSEDLSHK
LKELSNVRWVLPDSYLDVRNKDYGGEPFIDGKAVPYDPKYHEEWIRNNARANERNRRNDRPRNNDRSRNFERRRENMAGG
PPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPP
PNYGGAPPANNMGGAPPPNYGGGPPPQYGAVPPPQYGGAPPQNNNYQQQGSGMQQPQYQNNYPPNRDGSGNPYQG*

DNA
ATGGCGACGCATACCATTTCTCGATCCATTCTTTGCCGACCGGCGAAATCTCTTTCGTTTCTGTTCACGCGATCCTTTGC
TTCATCTGCTCCTCTCGCCAAATCTCCGGCGTCTTCTCTGCTCAGCCGGTCCCGTCCTCTGGTCGCCGCTTTTTCCTCCG
TTTTCCGTGGCGGCCTTGTGTCTGTCAAAGGTCTCTCGACGCAGGCTACATCGTCTTCTCTGAACGACCCGAATCCCAAC
TGGTCGAACAGGCCACCTAAGGAGACGATCCTGCTCGATGGTTGCGATTTCGAGCACTGGCTTGTCGTCGTGGAGCCACC
TCAGGGTGAGCCTACTAGAGATGAAATCATTGATAGCTACATCAAAACCCTAGCTCAGATTGTTGGCAGTGAAGACGAAG
CTAGGATGAAGATCTACTCGGTTTCAACTAGGTGCTACTATGCTTTTGGGGCACTTGTGTCAGAAGATCTTTCTCACAAG
TTAAAAGAGTTGTCAAATGTGCGCTGGGTTCTTCCTGACTCTTACCTGGATGTGAGGAACAAAGACTATGGAGGGGAACC
TTTCATCGATGGGAAGGCTGTTCCTTATGATCCTAAGTACCACGAGGAGTGGATAAGGAACAATGCTAGAGCAAATGAAA
GGAACAGACGCAATGACCGTCCTCGCAACAATGATAGAAGCAGAAACTTTGAGAGGAGAAGAGAGAACATGGCAGGAGGC
CCTCCTCCTCAACGTCCTCCCATGGGAGGCCCTCCTCCTCCTCCGCACATCGGTGGCTCTGCACCTCCTCCGCCTCATAT
GGGTGGCTCTGCACCTCCTCCACCTCACATGGGGCAGAACTATGGACCACCACCACCAAACAACATGGGAGGACCAAGGC
ATCCACCACCTTATGGAGCACCACCGCAAAACAACATGGGAGGACCGAGGCCACCTCAGAACTATGGAGGAACACCACCT
CCCAACTATGGAGGAGCACCACCAGCAAACAACATGGGAGGAGCACCACCACCAAACTATGGAGGAGGACCACCACCTCA
ATATGGAGCAGTACCACCACCTCAATACGGAGGAGCACCCCCACAGAACAACAACTACCAGCAGCAGGGTAGTGGAATGC
AGCAGCCACAGTACCAGAACAACTACCCACCTAACCGGGATGGCAGTGGCAACCCCTACCAGGGTTAA