Details for Arabidopsis Locus AT3G14980

Position : Chr3 ( 5`- 5039931 .. 5045403 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14980

Protein [Map View]
MLPGAEIEMLGGDCFEGSYEDHQIFREVFFGSDPGNTTKRCLVTGAINFECDSSKNVNSSLSSNSVVTSGYACPQGFEAS
ASRDGSDFNTKAKRVKLSGNKHLDARDEKGSALHGFPTSDIARETIPLHLVESSNKGVSTSSYLLKHSIVKGREVYLGGI
VSGKCKSLNLDKCDGKEFKAIASPVSQESFATRMISVGASTPHSEKACFPLQLNNGSKVSPNELIMSKTCLKIDPKEDPR
PLLYKYVCKVLTAARWKIEKRERSAGRKHVDTFYISPEGRKFREFGSAWKALGGILLADRKLMDTGTKKWTGINDFWSDL
SLTLLDIEENMKNLNLANTRALWWSALEPFVVVVFISKQVGSLRKGNKVEVARNSNPDKLKKEDTICLNLISGCPESVLT
VSEGSHLVHDVDANQEIHSDLEVQTKISSQKVSSRLERQSIIGKEISGTHEQEASKGIVASKLIAEDMHESVMRKNLHRR
SKKISDIKPASLDQHDSLDSNSLNSFEFQDKEMGNIHLVSKGSRDERLRNEKMNNSCCNSKKGRKKARKHYTQDDDLMGS
TITRNKGKFSRSSQKKKTQKPKARTKKRNNRGGCRLLPRSSSNVENHFFQGNWSILGPRTVLSWLIATKVISRDEVIQLR
DPDDDTVVKTGLVTKDGVVCTCCNKTVSLSEFKNHAGFNQNCPCLNLFMGSGKPFASCQLEAWSAEYKARRNGWRLEKAS
DDDPNDDSCGVCGDGGELICCDNCPSTFHQACLSMQVLPEGSWYCSSCTCWICSELVSDNAERSQDFKCSQCAHKYHGTC
LQGISKRRKLFPETYFCGKNCEKVYNGLSSRVGIINPNADGLSWSILKCFQEDGMVHSARRLALKAECNSKLAVALSIME
ESFLSMVDPRTGIDMIPHVLYNWGSTFARLDFDGFYTVVVEKDDVMISVASIRVHGVTIAEMPLVATCSKYRRQGMCRIL
VAAIEEMLMSLKVEKLVVAALPSLVETWTEGFGFKPMDDEERDALKRINLMVFPGTTLLKKTLYESTKPSTMKGVCLSKE
RNNPSNKEADLEPGLDKAGSPMSTQVESCDQMVPAGSDDEPSPGFPVPLGADQTEPTSETENPSRDSNANDRPNKTTVVS
IGEEEEEECLQKDVSKLSEEGKETTRASSSSAALEEVSGLGLGVVNNVSDEMLLCVDEQLDSDSSQDSE*

DNA
ATGCTTCCCGGAGCTGAGATTGAGATGTTAGGAGGTGACTGCTTTGAAGGGTCATATGAGGATCATCAGATATTCAGAGA
AGTTTTCTTTGGAAGTGATCCTGGAAATACTACTAAAAGATGTCTCGTTACTGGAGCCATTAACTTCGAATGTGATTCCA
GTAAGAATGTCAATTCCTCTCTGAGTTCCAACTCTGTGGTAACTAGTGGATATGCATGTCCACAAGGTTTTGAGGCATCT
GCTTCAAGAGATGGTTCAGATTTTAACACTAAAGCTAAGAGAGTGAAGCTTTCAGGTAATAAGCATTTGGATGCAAGGGA
CGAAAAGGGATCTGCTTTGCATGGTTTTCCAACTTCGGACATAGCTAGAGAGACGATACCTCTCCATTTAGTTGAATCAT
CTAACAAGGGTGTTTCAACTAGCTCATATTTGTTGAAGCACAGCATAGTAAAGGGAAGAGAAGTTTATCTGGGTGGCATT
GTGTCTGGAAAGTGTAAGTCACTAAACTTGGACAAATGCGATGGAAAGGAATTTAAAGCTATTGCCTCTCCTGTTTCTCA
GGAGAGCTTCGCAACCAGAATGATCTCTGTAGGTGCTTCTACGCCGCATAGTGAGAAGGCTTGCTTCCCGCTACAGTTGA
ACAACGGATCTAAAGTATCTCCTAATGAGTTAATTATGTCTAAAACCTGCCTAAAGATTGATCCTAAAGAGGACCCCCGT
CCTCTTCTCTACAAGTATGTCTGTAAGGTTCTAACTGCTGCCAGATGGAAAATTGAGAAGCGCGAAAGATCAGCAGGTAG
GAAACATGTAGACACATTTTACATATCGCCAGAGGGACGGAAATTTCGTGAATTTGGGTCAGCTTGGAAAGCATTGGGTG
GGATCCTATTAGCTGATCGTAAGTTAATGGATACTGGTACTAAGAAATGGACTGGTATTAATGACTTCTGGTCCGATCTC
TCTCTTACACTGTTGGACATCGAGGAGAACATGAAAAATTTAAATCTTGCTAACACACGGGCACTTTGGTGGAGTGCCTT
AGAGCCTTTTGTGGTTGTTGTCTTCATTTCTAAGCAAGTTGGTTCTTTAAGAAAAGGAAATAAAGTTGAAGTTGCAAGGA
ATTCAAATCCAGACAAGTTGAAGAAAGAAGATACAATTTGTTTGAACCTGATTTCAGGCTGTCCTGAAAGTGTGCTGACA
GTATCTGAAGGCAGTCATCTTGTTCATGACGTGGATGCTAACCAAGAGATACATTCAGATCTTGAGGTGCAAACTAAAAT
TTCCTCTCAAAAAGTTTCTTCAAGACTAGAGAGGCAGAGCATAATTGGTAAGGAAATCTCTGGGACTCATGAGCAGGAGG
CTAGCAAGGGCATTGTAGCTTCAAAATTGATAGCAGAAGACATGCATGAAAGTGTTATGAGAAAGAACTTACACAGAAGA
TCAAAGAAAATATCCGATATCAAACCAGCTTCCTTGGACCAACATGATTCACTAGATTCTAATTCTCTCAATAGCTTTGA
ATTCCAGGATAAAGAGATGGGCAACATTCACCTCGTCTCAAAGGGAAGTCGGGATGAAAGGTTGAGGAATGAGAAGATGA
ATAATTCATGTTGCAATTCAAAGAAAGGAAGAAAGAAAGCTAGGAAGCACTATACTCAAGATGATGACCTTATGGGGTCG
ACAATAACCAGAAACAAAGGTAAGTTCAGCAGATCAAGCCAGAAAAAGAAAACACAGAAGCCAAAGGCTAGAACAAAGAA
AAGAAACAATAGGGGAGGGTGCAGGTTGCTTCCCCGAAGCTCAAGCAATGTGGAAAATCATTTTTTTCAAGGAAATTGGT
CTATTTTGGGTCCTAGAACTGTCTTATCATGGTTGATAGCTACCAAAGTAATTTCTAGAGACGAAGTAATCCAGTTACGA
GATCCAGATGATGATACTGTGGTAAAAACAGGCCTGGTAACTAAAGATGGAGTGGTTTGTACATGTTGCAACAAGACTGT
GTCACTTTCTGAATTCAAGAACCATGCTGGATTTAACCAGAACTGTCCATGTCTGAATCTTTTCATGGGGTCAGGAAAGC
CTTTCGCTTCATGTCAGCTGGAAGCTTGGTCTGCTGAGTATAAGGCGCGAAGAAATGGATGGAGATTAGAGAAAGCCTCT
GATGATGATCCAAATGATGATTCTTGTGGAGTTTGTGGTGATGGGGGTGAGCTGATCTGCTGTGATAATTGTCCATCTAC
CTTCCATCAGGCGTGCTTATCAATGCAGGTGCTCCCTGAAGGAAGTTGGTATTGCTCGAGCTGCACATGTTGGATATGCA
GCGAGTTGGTTAGTGATAATGCTGAACGCTCTCAGGACTTTAAATGTTCCCAGTGTGCGCATAAATATCATGGAACATGT
TTGCAAGGGATAAGTAAACGCAGAAAGCTTTTTCCAGAGACCTACTTTTGTGGTAAAAATTGCGAGAAGGTGTACAATGG
TCTTAGTTCTCGTGTTGGGATCATTAACCCTAATGCTGATGGTCTGTCTTGGTCAATTCTTAAATGTTTTCAAGAAGATG
GAATGGTTCATTCTGCCCGAAGGTTGGCGCTGAAGGCTGAATGCAACTCGAAATTAGCTGTTGCCCTATCAATTATGGAG
GAAAGCTTTCTGTCTATGGTAGATCCAAGAACTGGTATTGACATGATACCTCATGTGCTATACAACTGGGGGTCAACATT
TGCTCGGTTAGACTTTGATGGGTTTTACACAGTGGTTGTGGAAAAGGATGATGTGATGATCTCAGTAGCATCTATCAGGG
TGCACGGAGTAACTATTGCAGAGATGCCTCTTGTAGCTACGTGCAGCAAATATCGCCGACAGGGCATGTGTAGAATCCTC
GTGGCTGCCATTGAAGAGATGCTTATGTCTCTCAAAGTGGAGAAGCTTGTGGTAGCTGCATTGCCGAGTTTAGTGGAAAC
TTGGACTGAAGGTTTTGGCTTCAAACCCATGGATGATGAAGAGCGTGATGCTCTCAAAAGAATAAACTTGATGGTATTCC
CTGGGACAACTCTGCTCAAGAAAACACTATACGAGAGCACAAAACCCAGCACTATGAAAGGTGTATGTCTTTCTAAAGAA
CGCAATAACCCATCAAACAAAGAAGCAGATCTAGAGCCAGGTCTAGACAAAGCCGGGTCTCCCATGAGTACCCAAGTTGA
GAGCTGTGATCAGATGGTTCCAGCAGGTTCAGATGATGAGCCATCCCCAGGCTTCCCCGTACCACTCGGAGCCGATCAAA
CAGAACCAACTTCAGAAACAGAGAACCCAAGCCGAGACAGCAATGCCAATGATAGGCCAAATAAAACAACAGTAGTCTCT
ATAGGAGAAGAAGAAGAAGAAGAATGTTTGCAGAAAGATGTATCAAAGTTATCAGAAGAAGGAAAAGAAACGACAAGGGC
TTCTTCTTCCTCTGCAGCTTTAGAAGAAGTTAGTGGTCTAGGACTAGGAGTAGTAAATAATGTTAGCGATGAGATGTTGC
TTTGTGTTGATGAACAGCTTGACTCTGATAGCTCTCAGGATTCGGAATAA