Details for Arabidopsis Locus AT3G14960

Position : Chr3 ( 5`- 5035896 .. 5038007 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14960

Protein [Map View]
MSSSPKLFHARPSFFTRRSTPLIVFTSLAIGLTGFLFGLSTILFPGLRLSGRSCLTNLPPKTVKIVWDVAGNSIVNGEVK
RHKVMGFVGIQTGFRSAGRRRALRNTWMPSDPEGLRRLEESTGLAIRFIIGKTKDEAKMVELRSEVAMYDDFILLDIEEE
YSKLPYKTLAFFKAAYALYDSEFYVKADDDIYLRPDRLSLLLAKERGHSQTYLGCMKKGPVFTDPKLKWYEPLADLLGKE
YFLHAYGPIYALSADVVTSLVALKNNSFRMFSNEDVTIGAWMLAMNVNHENLHTLCEPECSPYSIAVWDIPKCSGLCNPE
KRMLELHMLESCSKSPTLPSDDE*

DNA
ATGTCATCTTCTCCCAAGCTGTTTCACGCGCGTCCATCATTCTTCACGCGCCGATCGACGCCTTTGATCGTCTTCACCTC
TCTCGCTATCGGTCTAACCGGTTTCCTTTTCGGATTATCAACGATCCTTTTCCCTGGTCTCCGGTTATCTGGCCGGTCCT
GCCTCACCAACTTGCCACCGAAGACTGTTAAAATCGTCTGGGACGTCGCTGGTAATAGTATCGTTAATGGCGAAGTCAAG
AGGCACAAAGTGATGGGATTCGTCGGAATCCAGACCGGATTCAGATCTGCTGGCCGGAGACGAGCTCTCAGGAACACATG
GATGCCGTCCGATCCCGAAGGCCTTCGAAGATTGGAAGAATCAACAGGATTAGCCATTAGATTTATTATAGGCAAAACCA
AAGACGAGGCCAAAATGGTTGAGCTGAGAAGCGAAGTTGCAATGTACGATGACTTTATACTGCTCGATATCGAGGAGGAG
TACAGTAAGCTCCCCTACAAAACTTTGGCTTTCTTCAAAGCTGCATATGCACTATATGATTCAGAATTCTATGTCAAAGC
TGATGATGATATATACTTGAGGCCAGATCGTTTGTCTTTACTGTTGGCTAAAGAGCGGGGTCACTCGCAGACATACCTTG
GATGCATGAAAAAAGGTCCGGTTTTCACAGATCCAAAGCTTAAATGGTATGAACCTTTGGCAGATCTGCTCGGGAAAGAG
TACTTTCTTCATGCTTATGGCCCCATATATGCTCTTTCTGCTGATGTTGTCACTAGTTTGGTTGCCCTCAAGAACAACAG
TTTCAGGATGTTTAGCAATGAGGACGTGACCATAGGTGCGTGGATGCTGGCAATGAACGTTAACCACGAGAACCTTCACA
CCCTTTGTGAACCAGAGTGCTCACCATACTCCATTGCTGTTTGGGATATACCAAAATGCTCAGGCCTCTGTAACCCAGAG
AAAAGGATGTTGGAACTTCACATGCTAGAGAGCTGCTCAAAAAGCCCGACTTTGCCATCGGATGATGAGTGA