Details for Arabidopsis Locus AT3G14950

Position : Chr3 ( 5`- 5030216 .. 5032892 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14950

Protein [Map View]
MSKLKKPILESNCVADKLCDSLNMEDNNNDKPDTINVDLGSPITPLQTQPSGLSSSTSSFSSSSSGSVTGHAGHTPPVTR
KPDSVQPVPSASKSKSSNLSSAAKSSKSSTTPSSAAQFGGSYSPARAQSRASSQVGAKTGNIIRPSSNSASVTTKPSGNK
SSVSSKQSLKILPAGNLVPSGKVQITGMTQEKPRSMVLGPGAKSYGYGSIIRGNNLSPVKPTMMSDSSSVLPLTLSNNST
GGPDAYTSWKIAIYGSNPEEVKRFGNEMFRKGCFAEALKLYDRAIELSPSNATYHSNRAAALSSLGQIGEAVNECEIAIK
LDPNFARAHHRLASLLLRLGYVDNAGIHLYSVEEPLDPTVVKMLQQVDKHLNKCTYARRRGEWSIVLTEVSAAIASGADS
SPQLAMCKAEALLKLLRLDDAQRVLECVPKVEPFPASFSHTRFFDMIAEAYTSFVKSQMELALGRFENAVVTAEKASKID
PQNNEVEILYKNVRLITRARDRGNDLYELERYTEARSAYAEGLKYDPSNATLLCYRADCFFKVGMWESSIEDCNHALLIL
PSYTKPRLQRAALYTKLERWAEAVSDYEILRKELPYDKEIAESLFHAQVALKKSRGEVVLNMEFGGEVEEISSLEELKAA
LTRPASDPQCKEISTFVDALCVRYPSLHFLKVEIVKCPEVGNAERVRVVPTFKIYKLGIRMKEIVCPSKEALEKTVRHYG
L*

DNA
ATGTCGAAGCTCAAGAAACCTATACTAGAATCTAACTGTGTCGCCGATAAGCTCTGTGACTCGTTGAATATGGAAGATAA
TAACAATGATAAACCAGATACTATTAATGTCGATCTTGGATCACCAATTACACCGCTTCAGACTCAGCCGAGTGGACTCT
CTTCTTCCACCAGTAGTTTCAGTTCTAGCTCTTCTGGATCGGTCACAGGTCATGCCGGACATACTCCCCCGGTTACAAGA
AAACCAGATTCCGTTCAGCCCGTTCCCTCCGCCTCTAAGTCTAAATCTAGCAATCTCTCTTCCGCCGCGAAATCTTCAAA
GTCTAGTACTACTCCCTCCTCCGCCGCTCAATTTGGTGGGTCATATAGTCCTGCCCGTGCTCAATCACGTGCAAGCAGTC
AAGTTGGTGCTAAAACCGGGAATATAATAAGACCATCATCAAACTCAGCTTCGGTTACGACAAAACCATCTGGTAATAAA
AGCTCTGTTTCGTCGAAACAGAGCCTCAAAATACTTCCCGCCGGGAACCTTGTCCCATCGGGGAAGGTACAGATTACAGG
CATGACTCAAGAAAAACCAAGAAGCATGGTTCTTGGACCAGGTGCTAAATCATACGGTTACGGTAGCATTATACGAGGAA
ACAACTTATCTCCGGTGAAGCCAACGATGATGTCTGATTCTTCCTCTGTTTTGCCTTTAACTCTCAGTAATAACTCTACC
GGTGGTCCTGATGCATATACATCGTGGAAGATAGCTATATATGGTTCTAATCCTGAAGAAGTAAAGAGGTTTGGTAACGA
AATGTTCAGGAAAGGTTGTTTCGCTGAGGCTTTGAAGTTGTATGATCGAGCAATAGAGCTATCACCGAGTAATGCTACTT
ACCATAGCAACCGTGCAGCTGCATTGTCGAGTTTGGGTCAGATTGGTGAAGCTGTGAATGAATGTGAAATAGCTATCAAA
TTAGATCCAAACTTTGCAAGGGCTCATCACCGTTTAGCCTCATTGCTTCTTAGATTAGGTTATGTGGATAATGCAGGGAT
ACATTTATATTCAGTGGAGGAACCATTAGATCCAACGGTGGTGAAGATGCTTCAACAAGTAGATAAACACTTGAACAAAT
GCACATATGCAAGAAGACGCGGTGAATGGAGTATTGTTTTGACTGAAGTAAGTGCAGCCATTGCGTCTGGAGCTGATTCT
TCTCCTCAGCTAGCTATGTGTAAAGCTGAAGCACTACTGAAACTTCTTCGGCTTGATGATGCTCAAAGAGTACTAGAATG
TGTCCCCAAAGTGGAACCATTCCCAGCTTCTTTCTCACATACTCGGTTTTTCGATATGATCGCTGAAGCTTACACATCTT
TTGTCAAATCCCAAATGGAGTTGGCTCTAGGAAGGTTTGAAAATGCAGTTGTAACTGCAGAGAAAGCTTCAAAGATTGAT
CCACAAAACAATGAAGTTGAAATTTTGTATAAAAATGTTAGATTAATAACTAGAGCGCGTGATCGTGGTAACGATCTTTA
TGAACTAGAAAGATACACTGAAGCAAGATCAGCTTATGCAGAAGGCCTTAAGTATGATCCATCCAATGCTACTCTGTTAT
GTTACAGAGCAGATTGTTTCTTTAAGGTTGGAATGTGGGAGAGCTCAATAGAAGATTGTAACCATGCATTGCTTATACTA
CCGAGTTACACAAAGCCTCGTCTTCAAAGAGCTGCTTTATATACCAAGTTGGAAAGATGGGCTGAAGCAGTGAGTGATTA
TGAGATCTTAAGAAAGGAACTGCCTTATGACAAGGAAATTGCTGAATCTTTATTTCATGCTCAAGTTGCATTAAAGAAAT
CTCGCGGCGAAGTAGTTCTAAACATGGAATTTGGAGGTGAAGTTGAGGAAATATCTAGTCTTGAAGAGTTAAAAGCTGCA
TTAACTCGTCCTGCTTCTGATCCACAATGCAAGGAGATATCCACTTTCGTGGACGCACTATGTGTTCGTTACCCATCTTT
GCATTTCCTCAAGGTGGAGATTGTAAAATGTCCAGAAGTGGGTAATGCAGAAAGAGTGAGAGTTGTGCCAACATTTAAGA
TATACAAACTTGGGATTCGGATGAAAGAGATTGTGTGTCCAAGCAAGGAAGCGCTGGAGAAAACAGTGAGGCACTATGGC
CTTTAG