Details for Arabidopsis Locus AT3G14940

Position : Chr3 ( 5`- 5025238 .. 5029710 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14940

Protein [Map View]
MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQELYELSAEYEGKREPSKLEELG
SVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIKKLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDA
LKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANLYYNQIE
NLMFELSMWRCTDEFRVRADELHRNSRKDAAKHYIEFWKTIPPTEPYRVILGDVRDKLYHTRERSRQLLSNGISDIPEEA
TFTNVEQFLEPLELCYRSLCSCGDSPIADGSLLDFLRQVSTFGLSLVRLDIRQESERHTDVLDAITKHLDIGSSYRDWSE
EGRQEWLLAELSGKRPLFGPDLPKTEEISDVLDTFKVISELPSDCFGAYIISMATSPSDVLAVELLQRECHVKNPLRVVP
LFEKLADLEAAPAAVARLFSIDWYKNRINGKQEVMIGYSDSGKDAGRLSAAWELYKAQEELVKVAKKYGVKLTMFHGRGG
TVGRGGGPTHLAILSQPPDTVNGSLRVTVQGEVIEQSFGEAHLCFRTLQRFTAATLEHGMNPPISPKPEWRALLDEMAVV
ATEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPVWLGFGAAFRYAIK
KDVRNLHMLQDMYKQWPFFRVTIDLIEMVFAKGDPGIAALYDKLLVSEDLWAFGEKLRANFDETKNLVLQTAGHKDLLEG
DPYLKQRLRLRDSYITTLNVCQAYTLKRIRDANYNVTLRPHISKEIMQSSKSAQELVKLNPTSEYAPGLEDTLILTMKGI
AAGLQNTG*

DNA
ATGGCGGGTCGGAACATAGAGAAGATGGCATCTATTGATGCTCAGCTTCGGCAACTCGTTCCTGCTAAAGTCAGTGAAGA
CGATAAGCTTGTTGAGTACGATGCTCTTCTCCTTGATCGCTTTCTCGACATTCTCCAGGATTTACACGGCGAGGATCTCC
GTGAAACGGTTCAAGAGTTATACGAGCTTTCTGCTGAGTATGAAGGGAAGCGTGAGCCTAGCAAGCTTGAGGAGCTAGGG
AGTGTCCTAACGAGTTTGGATCCTGGTGACTCAATTGTTATCTCCAAGGCTTTCTCTCACATGCTTAACTTAGCCAATTT
GGCTGAGGAGGTGCAGATTGCTCACCGTCGCAGGATCAAGAAGCTGAAGAAAGGTGATTTCGTTGATGAGAGTTCTGCAA
CTACTGAATCCGATATTGAAGAGACTTTTAAGAGGCTCGTTTCGGATCTTGGTAAGTCTCCTGAAGAGATCTTTGATGCC
TTGAAGAATCAGACTGTGGATCTGGTTTTGACTGCTCATCCTACTCAGTCTGTGCGTAGATCATTGCTTCAGAAGCATGG
GAGGATAAGGGACTGTCTTGCTCAACTCTATGCAAAGGACATTACTCCTGATGACAAGCAGGAGCTAGATGAGTCTCTGC
AAAGAGAGATTCAAGCTGCATTCCGAACAGATGAGATTAGAAGAACACCTCCAACCCCACAAGATGAAATGAGAGCTGGA
ATGAGTTATTTCCACGAGACAATCTGGAAAGGTGTCCCCAAGTTCTTGCGCCGTGTGGACACAGCTCTGAAAAACATTGG
GATTGATGAACGTGTTCCTTACAATGCCCCATTGATTCAATTCTCTTCGTGGATGGGCGGTGATCGTGATGGTAATCCGA
GGGTCACACCTGAGGTCACTAGAGATGTGTGCTTGTTGGCTAGAATGATGGCTGCCAATCTCTACTATAACCAAATCGAG
AATCTGATGTTTGAGTTATCTATGTGGCGTTGCACTGATGAATTCCGTGTGCGGGCGGATGAACTGCACAGGAACTCAAG
GAAAGATGCTGCAAAACATTACATAGAATTCTGGAAGACAATTCCTCCAACTGAGCCATACCGTGTGATTCTTGGTGATG
TGAGGGATAAGCTGTATCACACACGTGAGCGTTCCCGCCAATTGCTGAGTAATGGAATCTCGGATATTCCTGAAGAAGCT
ACCTTCACTAATGTGGAACAGTTCTTGGAGCCTCTTGAGCTCTGTTACCGATCACTATGTTCATGTGGTGACAGCCCGAT
AGCTGATGGAAGCCTTCTTGATTTCTTGAGGCAAGTCTCTACCTTTGGACTCTCCCTTGTGAGACTTGACATCAGGCAAG
AGTCTGAACGCCACACAGATGTCTTGGATGCTATCACCAAGCACTTGGACATCGGTTCCTCCTATAGAGACTGGTCTGAA
GAAGGCCGACAGGAATGGCTTCTTGCTGAACTAAGCGGCAAACGTCCACTTTTCGGACCTGATCTTCCCAAAACCGAAGA
AATTTCTGATGTCCTGGACACATTCAAAGTCATATCTGAGCTGCCTTCAGATTGTTTTGGAGCTTATATTATCTCTATGG
CAACTTCACCTAGTGATGTGCTTGCGGTTGAGCTTTTACAGCGCGAATGCCATGTGAAAAATCCACTTAGAGTTGTTCCA
CTCTTTGAGAAGCTAGCTGATCTTGAAGCAGCTCCTGCCGCTGTTGCAAGACTCTTTTCTATAGACTGGTACAAAAACCG
TATTAACGGTAAACAAGAGGTTATGATTGGTTACTCAGATTCAGGGAAAGATGCAGGGCGTCTCTCAGCTGCTTGGGAGC
TATACAAAGCTCAAGAAGAGCTTGTGAAGGTTGCTAAGAAATATGGAGTGAAGCTAACTATGTTCCATGGCCGTGGTGGC
ACAGTCGGAAGAGGAGGTGGTCCTACTCATCTTGCTATATTGTCTCAGCCACCAGATACAGTTAATGGCTCTCTTCGAGT
CACGGTTCAGGGTGAAGTCATTGAGCAATCATTTGGGGAGGCACACTTATGCTTTAGAACACTTCAACGTTTCACAGCAG
CTACTCTAGAGCACGGAATGAACCCTCCGATTTCACCAAAACCCGAGTGGCGTGCTTTGCTTGATGAAATGGCGGTTGTT
GCAACTGAGGAATACCGATCTGTCGTTTTCCAAGAACCTCGATTCGTCGAGTATTTCCGCCTCGCTACTCCGGAGCTGGA
GTATGGACGTATGAATATTGGAAGTAGACCTTCAAAGCGAAAACCAAGCGGTGGGATCGAATCTCTCCGTGCAATCCCAT
GGATCTTTGCTTGGACGCAAACAAGATTCCATCTTCCTGTATGGTTAGGTTTCGGAGCAGCATTTAGGTATGCGATCAAG
AAGGATGTGAGAAACCTTCACATGCTGCAAGATATGTATAAACAATGGCCCTTTTTCCGAGTCACCATCGATCTAATTGA
AATGGTGTTCGCCAAGGGAGACCCCGGGATCGCTGCTTTGTACGACAAACTTCTTGTCTCAGAAGATTTATGGGCTTTTG
GAGAGAAACTCAGAGCCAACTTTGATGAAACCAAGAACCTCGTCCTCCAGACTGCTGGACATAAAGACCTTCTTGAAGGA
GATCCTTACTTGAAACAGAGACTAAGGCTACGTGACTCTTACATTACGACCCTCAACGTTTGCCAAGCCTACACATTGAA
GAGGATCCGTGATGCAAACTACAATGTGACTCTGCGACCACACATTTCTAAAGAGATCATGCAATCAAGCAAATCAGCAC
AAGAGCTCGTCAAGCTTAACCCCACGAGTGAATACGCGCCTGGACTTGAGGACACACTTATCTTAACCATGAAGGGTATT
GCTGCAGGATTGCAAAACACCGGTTAA