Details for Arabidopsis Locus AT3G14930

Position : Chr3 ( 5`- 5020570 .. 5022959 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14930

Protein [Map View]
MSLSSPTSACSSSRCYSSGLSFPIGFGSNPINVGLVCYPKRYSIAARKFVVACSSSSSDPLLVKAAKGQAISRPPAWMMR
QAGRYMAVYQKLAKKHPSFRERSENTDLIVEISLQPWQAFRPDGVIIFSDILTPLPAFGVPFDIEEVKGPVIQSPIRTEE
DMKRLHPIDFEKLQFVGDSLKILRREVGEHAAVLGFVGAPWTIATYIVEGGTTRTYTVIKNMCHTAPDVLRALLSHLTKA
ITEYVVYQVEHGAHCIQIFDSWGGQLTPEMWERWSKPYIEEIIHAVKKRCPDTPIVFYINGNGGLLERMKGTGADVIGLD
WTVDMADGRRRLGSEVSVQGNVDPAYLFSPLPALTEEIERVVKCAGPKGHILNLGHGVLVGTPEEAVAHFFETARNLDYQ
TLFQNHVPAEKAEPELVV*

DNA
ATGAGCTTATCATCGCCAACCAGTGCTTGTAGCTCGTCCAGATGTTACTCCTCGGGATTATCGTTTCCGATTGGATTTGG
ATCGAATCCCATCAATGTGGGATTGGTTTGTTACCCAAAAAGATACAGTATTGCTGCTCGGAAGTTCGTAGTGGCTTGCT
CCTCCTCCTCTTCCGATCCACTTTTGGTTAAGGCTGCAAAAGGGCAAGCCATAAGTCGTCCTCCAGCTTGGATGATGAGG
CAAGCAGGAAGGTATATGGCTGTTTACCAAAAGCTCGCCAAGAAACATCCGTCCTTCAGAGAGAGATCAGAGAACACTGA
TCTAATAGTGGAAATCTCTTTGCAGCCTTGGCAAGCATTCAGACCAGACGGTGTCATCATTTTCTCTGACATCCTCACCC
CTTTACCTGCATTCGGTGTCCCTTTTGATATTGAAGAGGTAAAAGGTCCTGTAATCCAATCTCCTATCCGAACTGAAGAA
GATATGAAGAGATTACATCCCATTGATTTCGAGAAACTACAGTTTGTTGGAGATTCTCTCAAGATTTTGAGACGAGAGGT
TGGGGAACATGCTGCGGTGTTGGGTTTCGTTGGAGCGCCTTGGACAATTGCAACATATATTGTTGAAGGAGGAACAACTC
GAACATATACAGTCATAAAGAATATGTGCCACACTGCACCAGATGTATTGAGAGCTCTATTATCTCATTTAACCAAGGCC
ATTACCGAGTATGTGGTTTACCAAGTTGAGCACGGAGCTCACTGCATACAAATATTCGATTCCTGGGGTGGCCAACTGAC
TCCGGAGATGTGGGAGCGCTGGTCCAAACCATACATTGAAGAGATCATACATGCTGTAAAGAAAAGATGTCCAGATACGC
CGATAGTTTTCTACATCAATGGAAATGGTGGCCTTCTTGAGCGAATGAAAGGAACTGGAGCTGATGTTATTGGACTTGAC
TGGACTGTAGATATGGCTGATGGAAGGAGGCGATTGGGAAGCGAGGTAAGTGTGCAGGGAAATGTTGATCCAGCTTACCT
ATTCTCTCCGCTTCCTGCTTTGACCGAAGAAATTGAAAGAGTTGTGAAGTGTGCTGGACCAAAAGGGCATATTCTCAATC
TAGGACACGGTGTCTTGGTAGGGACACCAGAGGAAGCCGTGGCTCATTTCTTTGAAACCGCTAGAAACTTGGATTACCAA
ACACTTTTCCAAAATCATGTTCCTGCAGAAAAAGCTGAACCTGAATTGGTTGTCTGA