Details for Arabidopsis Locus AT3G14910

Position : Chr3 ( 5`- 5015426 .. 5017805 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14910

Protein [Map View]
MAKRIHLTELGCIACEELTELGAGKEGWLVNNPNLLSALDSHSLALANRFLILIVNWGDPDAPRVKIRPDLSPIEAESIT
AIEWLVFDDVRVVVAGTSCGYLLVYSVTGDLIHKQIVHQSRILKIRVRGTKKDLMQETSSEEICIVLPGVIARFDGSNIQ
SMVQKWVQEKNSNFWDQKNRKGDAEDTGSLYQRLPYQIWNVNKNGVCVDATVTGVMPPPLLELQSSQRYYCAVTIGEDSV
ISAYRLSEDRGRSLVGAILSKVVPAAASTIASFSKLIWRSNDQSPKRKPEAKTQSFARASSLTCIKDYPRKGEKLTLSPS
GTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLAKKDKGKSVIHTEPVKSDYCLCLAIHAPRKGIIEVWQMR
TGPRLLTIQCAKGSKLLQPAYRFGSNSSSSPYIPLEVFLLNGDSGQVSMLNRSLS*

DNA
ATGGCGAAGAGGATCCACCTGACGGAACTAGGCTGCATCGCGTGTGAGGAACTTACTGAGCTCGGTGCGGGTAAAGAAGG
ATGGCTCGTGAACAATCCAAACCTTTTGAGTGCACTTGATTCTCACTCTTTAGCCCTAGCCAATCGATTTCTCATATTGA
TTGTGAATTGGGGTGATCCTGATGCGCCTCGTGTCAAGATCAGACCTGATCTGTCTCCGATTGAGGCTGAGTCGATTACG
GCGATCGAGTGGTTAGTGTTTGATGATGTCAGAGTCGTCGTTGCGGGGACTTCTTGTGGATATCTCTTGGTTTACTCTGT
TACCGGTGATCTGATCCATAAGCAGATTGTACATCAAAGCCGTATATTAAAAATAAGAGTTCGAGGAACTAAGAAAGATT
TGATGCAAGAGACATCCTCTGAGGAGATTTGCATTGTATTGCCTGGTGTTATTGCCCGCTTTGATGGCTCTAACATTCAG
AGTATGGTTCAGAAATGGGTTCAAGAGAAGAATTCGAACTTTTGGGACCAAAAGAATAGAAAGGGAGATGCAGAAGATAC
TGGTAGCTTGTACCAACGTCTACCGTATCAGATATGGAATGTCAACAAGAATGGTGTGTGTGTTGATGCTACTGTCACTG
GCGTAATGCCTCCTCCGTTACTGGAACTCCAGTCAAGTCAACGTTATTATTGTGCAGTGACCATTGGAGAGGATTCTGTA
ATCTCAGCTTACAGGCTCTCAGAAGATAGAGGGAGATCACTTGTTGGAGCGATTCTATCAAAAGTTGTGCCTGCAGCTGC
TTCAACGATAGCTTCTTTCTCTAAACTGATCTGGAGAAGTAATGATCAATCACCAAAGCGAAAGCCAGAAGCCAAGACTC
AGTCATTCGCTCGAGCATCGTCCTTGACATGTATAAAGGACTACCCAAGGAAAGGAGAGAAGCTCACGTTATCCCCGAGT
GGAACATTAGCTGCCATAACAGATTCTCTTGGTCGAATACTTCTGCTAGACACTCAAGCTCTTGTAGTTGTCCGGCTATG
GAAGGGTTATCGTGATGCAAGCTGTGTGTTCATGGAGATGTTAGCCAAAAAAGATAAAGGAAAATCTGTGATTCACACAG
AACCGGTAAAAAGTGATTATTGTCTATGCTTAGCCATTCATGCTCCACGCAAAGGCATCATCGAGGTGTGGCAGATGAGA
ACGGGGCCACGTCTTCTAACGATTCAATGCGCAAAAGGTAGCAAATTGTTGCAGCCAGCGTACAGGTTTGGATCAAATTC
TTCATCTTCTCCTTACATTCCTCTTGAAGTCTTCTTACTCAATGGAGATTCCGGCCAAGTCTCTATGCTCAACCGATCTC
TCTCTTAA