Details for Arabidopsis Locus AT3G14880

Position : Chr3 ( 5`- 5006565 .. 5007689 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14880

Protein [Map View]
MSQETAIASFKKFQQSWIEQLRNHLNHLRSAQNHHRNSATGDEERLREAVDRVMEHFREYHRAKWAATDKDVIEVMASPW
ASALERSLQWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSPSQFRVPFVKGRTVSELQCETVKEENAIT
EELSEWQDDASDLVMGTSSDPDQRIRRLAEIVHRTDDLRLRTITRVVEVLSPLQQAEFLVAAAELRTGVAGWGTSHDRRR
SSEV*

DNA
ATGAGCCAAGAGACAGCGATAGCAAGCTTCAAGAAATTCCAACAGTCATGGATCGAGCAGCTACGAAACCACCTGAACCA
CCTCCGCTCCGCCCAAAACCATCACCGGAACTCTGCTACCGGTGATGAGGAACGGTTAAGGGAGGCTGTGGACAGAGTGA
TGGAACACTTTAGAGAATATCACAGGGCCAAGTGGGCTGCGACGGATAAAGACGTCATCGAAGTTATGGCTTCTCCTTGG
GCTTCAGCTCTTGAACGGTCGCTTCAGTGGGTCGGTGGTTGGCGACCAACCACCTTGTTCCATCTGGTTTACACTGAGTC
GAGTATTTTATTTGAGTCTCGTATCGTTGATATACTTCGTGGCTTTCGCACCGGTGATCTCAGTGATCTCTCCCCTTCTC
AGTTCAGGGTTCCATTTGTCAAAGGCAGGACGGTAAGTGAGCTACAATGTGAGACCGTGAAGGAAGAGAATGCGATAACG
GAAGAGTTGTCGGAGTGGCAAGACGATGCGAGTGACCTTGTCATGGGGACATCGTCAGATCCCGACCAGAGGATCCGACG
GCTAGCAGAAATCGTCCACCGAACTGATGATCTGCGACTGAGAACGATCACACGTGTGGTGGAGGTCTTGAGTCCGCTCC
AACAAGCGGAGTTTCTTGTCGCTGCGGCTGAGCTTCGTACAGGCGTTGCTGGTTGGGGGACTAGCCACGACCGTCGTCGA
AGTTCCGAAGTTTAA