Details for Arabidopsis Locus AT3G14860

Position : Chr3 ( 5`- 4998357 .. 5001046 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14860

Protein [Map View]
MGKSQILLNAESFTCSSFNTFFTLWIFFTLHSFPFQAQAAPSGSLIKHMSSVLKWTTGSSSKLSQSDTNVLQFENGYLVE
TVVEGNDIGVVPYKIRVSDDGELYAVDELNSNIMKITPPLSQYSRGRLVAGSFQGKTGHADGKPSEARFNHPRGVTMDDK
GNVYVADTLNLAIRKIGDSGVTTIAGGKSNIAGYRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLSEEDCD
YQDDSSISLTDILLVIGAVLIGYATCMLQQGFGNSFFSKTQVGSETSYEEEHPGKEKLSRPVHEKTITKEEPGWPSFGQL
LTDLCKLALEFITSHLVPARFQTNPNLRPLKDRLIMPEDEQEPPRVQRHTAPAPISESRHAHLPKADDSYPEHKTPKLRS
SSVMKDPTLSSSKHHRTSSKRQDYAQFYASGEVAQPKIHKERSRRRHRDKTTETEPKPTPSDTVKPVEYSNSSKFDHYNM
RSSKYGPETPFRF*

DNA
ATGGGCAAATCTCAGATTCTTCTAAACGCTGAGAGCTTTACTTGTTCTTCTTTCAATACTTTCTTCACTTTATGGATCTT
CTTTACTCTTCACTCCTTTCCATTTCAAGCTCAAGCTGCTCCTTCTGGTTCCTTGATTAAGCACATGTCATCGGTTCTCA
AGTGGACTACTGGATCATCCTCTAAATTATCCCAATCAGACACTAATGTTCTTCAGTTTGAGAATGGTTACTTGGTCGAA
ACTGTTGTGGAAGGAAACGATATTGGTGTTGTTCCTTACAAGATTCGAGTTTCTGATGATGGAGAACTTTATGCTGTTGA
TGAACTTAATAGCAACATCATGAAAATCACTCCTCCCTTGTCTCAGTACAGCAGGGGAAGATTGGTGGCTGGATCTTTTC
AAGGAAAAACAGGGCATGCAGATGGAAAACCGAGTGAGGCTCGTTTTAACCATCCGAGAGGCGTTACAATGGATGACAAA
GGGAACGTTTATGTCGCTGATACTTTGAATCTCGCCATCCGAAAGATTGGTGATTCAGGTGTTACTACGATAGCTGGGGG
AAAATCAAATATAGCTGGGTATAGAGATGGGCCAAGTGAGGATGCAAAGTTCTCAAATGATTTTGATGTCGTATATGTTC
GGCCTACCTGCTCGTTGCTGGTCATCGATAGAGGAAATGCGGCTCTTCGCCAAATCTCTCTCAGTGAAGAGGACTGTGAC
TATCAAGATGATAGCTCAATCTCTCTAACTGATATACTCTTGGTTATTGGTGCTGTTCTCATTGGTTATGCTACTTGTAT
GCTCCAGCAGGGCTTTGGAAATTCTTTCTTCTCAAAGACGCAGGTAGGATCAGAAACCAGCTATGAAGAAGAGCATCCAG
GAAAAGAGAAACTCTCCCGGCCTGTCCATGAGAAAACAATAACCAAGGAAGAACCTGGTTGGCCATCATTTGGGCAACTC
CTTACTGATCTCTGCAAACTTGCTCTCGAGTTTATAACCAGCCACCTAGTTCCAGCCCGATTCCAAACCAACCCCAATCT
AAGGCCATTAAAAGATAGACTCATAATGCCTGAAGACGAACAAGAACCACCTCGAGTCCAAAGGCATACTGCCCCAGCAC
CAATCTCAGAATCCCGACATGCTCACTTACCTAAAGCTGATGATAGTTACCCTGAACATAAGACGCCAAAGCTAAGATCA
AGTAGTGTAATGAAGGACCCTACTTTGTCATCATCCAAGCACCATCGGACATCATCAAAACGGCAGGACTATGCTCAGTT
CTATGCCTCGGGAGAGGTTGCCCAACCGAAGATCCATAAAGAGCGGTCAAGGCGTCGTCATAGAGATAAAACAACCGAGA
CAGAACCAAAGCCAACACCATCAGATACGGTGAAGCCTGTGGAGTACAGTAATAGTTCAAAGTTTGATCATTACAACATG
AGGAGCAGCAAGTATGGACCTGAAACTCCATTTCGATTCTAG