Details for Arabidopsis Locus AT3G14840

Position : Chr3 ( 5`- 4988107 .. 4994058 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14840

Protein [Map View]
MSLNRQLLFTYYFIVSLILFSDFVSSATLPKEEVDALQSVATALKKSNWNFSVDPCDETLSEGGWRNPNAAKGFEDAVTC
NCSSVICHVTNIVLKAQDLQGSLPTDLSGLPFLQELDLTRNYLNGSIPPEWGASSLLNISLLGNRISGSIPKELGNLTTL
SGLVLEYNQLSGKIPPELGNLPNLKRLLLSSNNLSGEIPSTFAKLTTLTDLRISDNQFTGAIPDFIQNWKGLEKLVIQAS
GLVGPIPSAIGLLGTLTDLRITDLSGPESPFPPLRNMTSMKYLILRNCNLTGDLPAYLGQNRKLKNLDLSFNKLSGPIPA
TYSGLSDVDFIYFTSNMLNGQVPSWMVDQGDTIDITYNNFSKDKTEECQQKSVNTFSSTSPLVANNSSNVSCLSKYTCPK
TFYGLHINCGGNEITSNETKYDADTWDTPGYYDSKNGWVSSNTGNFLDDDRTNNGKSKWSNSSELKITNSSIDFRLYTQA
RLSAISLTYQALCLGKGNYTVNLHFAEIMFNEKNMYSNLGRRYFDIYVQGKREVKDFNIVDEAKGVGKAVVKKFPVMVTN
GKLEIRLQWAGKGTQAIPVRGVYGPLISAVSVDPDFIPPKEPGTGTGGGSSVGTVVGSVIASTVFLVLLIGGILWWRGCL
RPKSQMEKDFKNLDFQISSFSLRQIKVATDNFDPANKIGEGGFGPVHKGIMTDGTVIAVKQLSAKSKQGNREFLNEIAMI
SALQHPHLVKLYGCCVEGDQLLLVYEYLENNSLARALFGPQETQIPLNWPMRQKICVGIARGLAYLHEESRLKIVHRDIK
ATNVLLDKELNPKISDFGLAKLDEEENTHISTRVAGTYGYMAPEYAMRGHLTDKADVYSFGVVALEIVHGKSNTSSRSKA
DTFYLLDWVHVLREQNTLLEVVDPRLGTDYNKQEALMMIQIGMLCTSPAPGDRPSMSTVVSMLEGHSTVNVEKLLEASVN
NEKDEESVRAMKRHYATIGEEEITNTTTTDGPFTSSSTSTANANDLYPVKLDSAYWNTRT*

DNA
ATGTCGTTAAATCGACAACTTCTATTCACTTACTACTTCATCGTCTCTCTTATCCTCTTCTCCGATTTCGTATCCTCTGC
AACATTACCAAAAGAAGAAGTGGATGCTTTACAAAGCGTCGCGACGGCGTTGAAGAAGAGTAATTGGAATTTCAGTGTGG
ATCCATGTGACGAAACCTTGTCTGAAGGCGGATGGAGGAATCCTAACGCCGCTAAGGGATTCGAAGACGCCGTTACTTGT
AACTGCTCCTCCGTCATCTGCCACGTCACCAACATAGTTCTCAAGGCACAAGACCTTCAAGGATCTCTTCCTACAGATCT
TTCAGGACTTCCTTTCTTGCAAGAGCTTGATCTGACTAGAAACTATCTCAACGGTTCCATTCCTCCCGAATGGGGAGCCT
CATCACTTCTAAACATCTCACTACTTGGAAACCGGATAAGTGGTTCAATCCCAAAAGAACTTGGAAACCTTACAACCCTT
TCTGGTCTTGTCTTGGAATACAACCAACTCTCAGGGAAGATACCTCCAGAGCTCGGGAATCTACCAAACCTTAAAAGACT
GTTACTTAGCTCGAATAACTTGAGCGGGGAAATCCCAAGTACATTCGCCAAACTTACTACGTTGACTGATTTACGTATTA
GTGACAACCAGTTCACTGGTGCTATACCAGATTTCATCCAGAACTGGAAAGGACTAGAGAAACTGGTTATTCAAGCAAGT
GGTTTAGTTGGACCGATTCCTAGTGCCATTGGTCTTCTGGGAACCTTGACAGACTTGAGAATCACTGACTTGAGTGGACC
TGAATCTCCATTTCCGCCACTAAGAAACATGACATCGATGAAGTATTTGATTCTTAGGAACTGTAACCTTACAGGAGACT
TACCTGCGTATCTTGGACAGAATAGAAAATTAAAGAATCTAGATCTTAGCTTTAACAAACTGAGTGGACCAATCCCAGCC
ACATATTCCGGTCTTTCAGATGTAGATTTCATATACTTTACAAGTAACATGTTAAATGGACAAGTACCAAGTTGGATGGT
AGACCAAGGAGACACGATTGATATTACTTACAATAACTTCTCCAAAGATAAAACCGAAGAATGTCAACAAAAATCCGTGA
ACACGTTTTCAAGCACAAGCCCTTTAGTGGCAAATAACTCCTCAAATGTTTCGTGTCTGAGTAAATATACCTGTCCTAAA
ACTTTCTACGGCCTTCATATAAACTGTGGTGGTAATGAAATAACAAGCAATGAGACTAAGTATGATGCTGACACATGGGA
TACACCGGGTTACTATGATAGTAAAAACGGGTGGGTTTCTAGCAACACGGGAAACTTCTTGGATGATGATCGGACTAACA
ATGGAAAATCAAAATGGTCGAATTCATCAGAGCTTAAGATAACAAATTCTAGCATAGATTTTAGGCTTTACACACAAGCG
CGTCTCTCGGCTATCTCCCTCACTTACCAGGCATTGTGTCTTGGAAAAGGAAACTATACGGTTAATCTTCATTTCGCTGA
AATTATGTTCAATGAAAAGAACATGTATAGCAATTTGGGAAGACGATACTTCGACATATACGTTCAGGGTAAACGTGAAG
TGAAAGATTTCAATATCGTTGATGAAGCAAAAGGTGTGGGAAAAGCTGTTGTTAAGAAATTTCCTGTCATGGTTACAAAT
GGGAAACTGGAAATAAGATTGCAGTGGGCTGGGAAAGGAACTCAAGCTATTCCTGTGAGAGGTGTCTATGGTCCTCTCAT
ATCTGCTGTATCGGTAGATCCAGATTTTATTCCACCAAAGGAACCGGGCACTGGAACTGGTGGTGGAAGTTCTGTTGGTA
CAGTGGTTGGTAGTGTAATCGCTTCTACGGTGTTTCTTGTGCTTTTAATCGGCGGTATATTATGGTGGAGAGGCTGCTTA
AGACCCAAGAGTCAGATGGAAAAAGATTTCAAGAACTTAGATTTCCAGATCAGTTCGTTCTCCTTGAGGCAAATCAAAGT
TGCCACGGATAACTTTGATCCTGCAAACAAGATCGGAGAAGGTGGTTTTGGTCCTGTACACAAGGGAATAATGACTGATG
GAACTGTAATCGCGGTGAAGCAGCTATCGGCAAAATCAAAACAAGGGAATCGAGAATTCTTAAACGAGATTGCTATGATT
TCGGCTCTGCAGCATCCACATTTGGTTAAACTATATGGATGTTGCGTTGAAGGTGATCAGCTCCTGCTAGTTTACGAGTA
CTTGGAGAACAACAGTCTCGCGCGAGCTCTTTTCGGACCTCAAGAGACTCAGATACCACTAAATTGGCCAATGAGGCAGA
AGATTTGTGTTGGAATAGCGAGAGGATTAGCTTATCTCCACGAGGAATCAAGACTCAAGATCGTACACAGAGACATCAAA
GCCACTAATGTCTTGCTGGATAAGGAACTAAACCCAAAGATTTCAGATTTTGGGCTTGCTAAGCTTGATGAAGAAGAAAA
CACACACATCAGCACACGAGTCGCTGGAACATATGGATACATGGCTCCAGAATACGCCATGAGAGGCCATTTGACAGATA
AAGCCGACGTCTACAGTTTTGGCGTTGTGGCCCTAGAAATCGTTCACGGAAAGAGCAACACGAGCTCACGATCTAAAGCT
GATACCTTCTACCTTCTTGACTGGGTGCACGTTTTAAGGGAACAAAACACTCTACTTGAAGTAGTAGATCCAAGGCTAGG
AACAGATTACAACAAACAAGAAGCATTGATGATGATTCAGATAGGGATGCTCTGTACCAGTCCAGCTCCAGGGGATAGAC
CTTCGATGTCGACGGTGGTGAGTATGCTCGAAGGCCATTCAACGGTGAATGTTGAGAAACTTCTTGAAGCTTCGGTCAAC
AATGAAAAGGACGAAGAGAGTGTGAGAGCGATGAAAAGGCATTACGCCACGATAGGTGAGGAGGAGATAACGAACACGAC
AACTACCGATGGACCTTTCACGTCGTCTTCTACGTCAACCGCCAACGCCAACGATCTTTACCCTGTTAAGCTCGACTCTG
CCTATTGGAACACTAGAACTTAA