Details for Arabidopsis Locus AT3G14790

Position : Chr3 ( 5`- 4964155 .. 4967075 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14790

Protein [Map View]
MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFVKGDIASADLVNYLLITEE
IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYS
ATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMNGKPLPIHGDGSNVRSYLYCEDVAEAFEVVLH
KGEVNHVYNIGTTRERRVIDVANDISKLFGIDPDSTIQYVENRPFNDQRYFLDDQKLKKLGWCERTNWEEGLRKTMEWYT
ENPEWWGDVSGALLPHPRMLMMPGDRHSDGSDEHKNADGNQTFTVVTPTKAGCSGDKRSLKFLIYGKTGWLGGLLGKLCE
KQGIPYEYGKGRLEDRASLIADIRSIKPSHVFNAAGLTGRPNVDWCESHKTETIRVNVAGTLTLADVCRENDLLMMNFAT
GCIFEYDAAHPEGSGIGFKEEDKPNFTGSFYSKTKAMVEELLREFDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNI
PNSMTILDELLPISIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIEPDFKWSNFNLEEQAKVIVAPRSNNEMDGAKLS
KEFPEMLSIKDSLIKYVFEPNKRT*

DNA
ATGGCTACATATAAGCCTAAGAACATCCTCATCACTGGGGCTGCTGGATTCATAGCCTCTCATGTTGCTAACAGACTAGT
TCGCAGCTACCCTGACTACAAAATTGTTGTGCTTGACAAGCTTGATTACTGTTCTAATCTGAAGAACCTTAATCCTTCTA
AATCCTCTCCCAACTTCAAGTTTGTGAAAGGAGATATCGCCAGTGCTGATCTCGTCAACTACCTTCTCATCACTGAAGAA
ATCGACACCATTATGCACTTTGCTGCTCAAACCCATGTTGACAATTCTTTCGGTAATAGCTTTGAGTTTACCAAGAACAA
TATTTATGGTACCCATGTCCTTTTGGAAGCTTGTAAAGTCACTGGCCAGATCAGGAGGTTCATCCATGTGAGTACTGATG
AGGTCTATGGAGAGACTGATGAGGATGCTTCAGTGGGTAATCACGAGGCTTCTCAGTTGCTCCCAACTAATCCATACTCC
GCCACTAAAGCTGGAGCTGAGATGCTTGTCATGGCATATGGTAGATCATATGGGTTGCCGGTTATAACAACTCGCGGGAA
CAATGTTTATGGTCCTAACCAGTTTCCTGAAAAGTTGATTCCTAAGTTCATCCTCTTGGCCATGAATGGGAAGCCTCTCC
CAATCCACGGAGATGGATCTAATGTGAGAAGTTATCTCTACTGCGAAGATGTTGCTGAGGCATTTGAGGTTGTTCTTCAC
AAAGGGGAAGTTAACCATGTCTACAATATAGGGACAACGAGAGAAAGGAGAGTGATTGATGTGGCTAATGACATCAGTAA
ACTCTTTGGGATAGACCCTGACTCCACCATTCAGTATGTGGAAAACCGGCCATTCAATGACCAGAGGTACTTCCTCGATG
ACCAGAAGCTGAAGAAATTAGGATGGTGTGAGCGAACCAATTGGGAAGAAGGACTGAGGAAGACAATGGAATGGTATACT
GAGAACCCTGAGTGGTGGGGCGATGTTTCTGGAGCTCTGCTTCCTCATCCACGGATGTTGATGATGCCCGGTGACCGACA
CTCTGATGGCTCTGACGAGCACAAGAATGCAGATGGTAATCAGACATTCACGGTGGTTACTCCCACCAAGGCTGGTTGTT
CCGGAGACAAAAGATCCTTGAAGTTCCTCATCTATGGGAAGACTGGGTGGCTCGGTGGTCTTCTGGGAAAACTATGTGAG
AAACAAGGGATTCCTTACGAGTATGGAAAAGGAAGACTAGAGGATAGAGCTTCTCTCATCGCAGATATTCGCAGCATCAA
ACCAAGTCATGTCTTCAACGCCGCTGGTTTAACTGGGAGACCCAATGTTGACTGGTGTGAATCTCACAAAACTGAAACCA
TCCGAGTCAACGTTGCTGGAACTTTGACTCTTGCAGATGTTTGCAGAGAGAATGATCTGTTGATGATGAACTTTGCCACT
GGTTGTATATTCGAGTATGACGCTGCACATCCAGAAGGTTCAGGGATTGGTTTTAAGGAAGAAGATAAACCGAATTTCAC
TGGTTCTTTCTACTCAAAAACAAAGGCAATGGTGGAAGAGCTTCTAAGAGAATTTGACAACGTATGCACCTTGAGAGTGC
GGATGCCAATCTCATCTGACTTAAATAACCCGCGAAACTTCATCACGAAGATCTCGCGTTACAACAAAGTGGTGAACATT
CCAAACAGCATGACCATACTAGATGAACTCTTACCAATCTCGATCGAGATGGCGAAGAGGAACCTAAGGGGAATATGGAA
CTTCACCAATCCAGGAGTGGTGAGCCACAACGAGATATTAGAGATGTACAAGAGTTACATCGAGCCTGATTTCAAATGGT
CCAACTTCAATTTGGAAGAACAGGCTAAGGTCATTGTTGCTCCACGGAGCAACAACGAGATGGATGGTGCCAAGCTCAGC
AAGGAGTTTCCAGAGATGCTTTCCATCAAAGATTCGTTGATCAAATACGTCTTCGAACCTAACAAGAGAACGTAA