Details for Arabidopsis Locus AT3G14770

Position : Chr3 ( 5`- 4957334 .. 4959704 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14770

Protein [Map View]
MDVFAFNASLSMCKDVAGIAGNIFAFGLFVSPMPTFRRIMRNKSTEQFSGLPYIYALLNCLICLWYGTPFISHSNAMLMT
VNSVGATFQLCYIILFIMHTDKKNKMKMLGLLFVVFAVVGVIVAGSLQIPDQLTRWYFVGFLSCGSLVSMFASPLFVINL
VIRTKSVEFMPFYLSLSTFLMSASFLLYGLFNSDAFVYTPNGIGTILGIVQLALYCYYHRNSIEEETKEPLIVSYV*

DNA
ATGGATGTTTTTGCTTTCAATGCTTCTTTATCCATGTGTAAAGATGTTGCCGGAATCGCAGGCAACATATTTGCATTTGG
ACTCTTCGTTTCACCAATGCCAACGTTTAGGAGGATCATGAGGAACAAATCGACGGAGCAATTCTCCGGTTTACCATACA
TTTACGCTCTCTTAAACTGCTTGATCTGCCTTTGGTATGGCACACCTTTCATATCACACAGCAATGCCATGCTTATGACT
GTGAATTCCGTTGGAGCTACGTTTCAGCTTTGCTACATTATCCTCTTCATCATGCATACAGACAAGAAGAACAAGATGAA
GATGCTTGGTTTGCTTTTTGTGGTGTTTGCTGTGGTTGGAGTGATTGTAGCTGGAAGTTTGCAGATACCTGACCAGCTCA
CACGGTGGTACTTTGTCGGGTTCTTGAGCTGCGGTTCTCTTGTTTCAATGTTTGCCTCGCCGTTGTTTGTTATTAACCTA
GTGATTCGGACTAAGAGCGTTGAGTTTATGCCGTTTTATCTCTCGCTATCGACTTTCTTGATGAGTGCTTCCTTCCTTCT
TTACGGGTTATTCAACAGCGATGCCTTTGTTTATACACCAAATGGAATAGGAACGATTCTTGGCATTGTGCAGCTGGCTT
TGTACTGTTACTACCACAGGAATTCTATAGAAGAAGAAACAAAAGAGCCTTTGATTGTTTCTTACGTGTGA