Details for Arabidopsis Locus AT3G14760

Position : Chr3 ( 5`- 4956349 .. 4957255 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14760

Protein [Map View]
MEALWKLEEKLKLTTKEAVVILVGTAAAVTLLCIAAAFLNRNSRGKQVADAEWASETAFGSRTMEEKRKCKWSKVKRTLM
GSFCWSSAAKWMEMETRRQPPLLAVKERSLNAVDPVWQRPILMGEKCELPRFSGLILYDECGHPRHHPQLQEKVKQSSVV
RTTLRDLL*

DNA
ATGGAAGCCTTGTGGAAGTTGGAGGAGAAACTGAAGCTAACTACGAAAGAAGCCGTTGTGATCTTGGTCGGAACAGCGGC
TGCGGTAACGCTACTCTGCATAGCCGCAGCGTTTCTCAACCGCAATTCTCGAGGGAAGCAAGTAGCAGACGCAGAGTGGG
CGTCTGAAACAGCGTTTGGGTCAAGGACTATGGAGGAAAAGAGGAAATGTAAGTGGAGCAAAGTGAAAAGAACGTTGATG
GGTTCTTTTTGTTGGAGCTCTGCTGCGAAGTGGATGGAGATGGAAACAAGGCGGCAGCCACCATTGCTTGCGGTTAAAGA
AAGGAGTCTTAATGCGGTTGATCCGGTTTGGCAGCGACCAATTCTGATGGGTGAGAAATGTGAATTGCCTCGGTTTAGCG
GCCTTATATTGTATGATGAATGTGGCCATCCGCGTCATCATCCTCAGCTTCAAGAAAAAGTAAAACAGAGTTCTGTGGTA
AGAACAACTCTGAGAGATTTGCTTTGA