Details for Arabidopsis Locus AT3G14750

Position : Chr3 ( 5`- 4953576 .. 4955656 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14750

Protein [Map View]
MSGRNRGPPPPSMKGGSYSGLQAPVHQPPFVRGLGGGPVPPPPHPSMIDDSREPQFRVDARGLPPQFSILEDRLAAQNQD
VQGLLADNQRLAATHVALKQELEVAQHELQRIMHYIDSLRAEEEIMMREMYDKSMRSEMELREVDAMRAEIQKIRADIKE
FTSGRQELTSQVHLMTQDLARLTADLQQIPTLTAEIENTKQELQRARAAIDYEKKGYAENYEHGKIMEHKLVAMARELEK
LRAEIANSETSAYANGPVGNPGGVAYGGGYGNPEAGYPVNPYQPNYTMNPAQTGVVGYYPPPYGPQAAWAGGYDPQQQQQ
QQPPPQGQGHR*

DNA
ATGTCTGGAAGAAATCGTGGACCTCCTCCTCCATCAATGAAAGGTGGATCTTACAGTGGTTTACAAGCTCCGGTTCATCA
ACCGCCTTTCGTTAGAGGCTTAGGAGGAGGACCAGTGCCTCCTCCTCCTCATCCTTCTATGATTGATGATAGTAGAGAAC
CTCAATTTAGAGTAGATGCAAGAGGTCTTCCTCCACAATTTTCGATTCTGGAGGATCGTCTCGCTGCTCAGAATCAAGAT
GTTCAGGGCTTACTCGCTGATAACCAGAGACTGGCTGCGACTCATGTTGCGCTTAAACAGGAGTTAGAAGTTGCTCAGCA
TGAATTGCAAAGAATAATGCATTACATTGATTCCTTGAGAGCTGAGGAAGAGATTATGATGAGGGAGATGTATGATAAAT
CTATGCGATCCGAAATGGAATTGCGTGAAGTCGATGCTATGCGAGCTGAGATTCAAAAGATCCGTGCGGATATCAAAGAG
TTTACTTCAGGTAGACAGGAACTAACGAGTCAGGTTCACCTGATGACTCAAGATTTAGCTAGACTTACAGCAGATTTGCA
GCAGATACCAACGTTAACTGCAGAAATTGAGAACACAAAGCAAGAGCTGCAACGCGCAAGAGCGGCTATTGATTATGAGA
AGAAAGGGTACGCGGAAAACTACGAGCATGGCAAAATTATGGAGCATAAATTAGTTGCAATGGCTCGGGAACTGGAGAAG
CTTCGAGCAGAGATTGCTAACTCAGAAACGAGTGCTTATGCTAATGGTCCTGTTGGGAATCCTGGTGGAGTTGCTTATGG
TGGTGGATATGGAAATCCTGAGGCTGGGTATCCTGTGAATCCTTATCAACCCAACTATACCATGAATCCAGCACAAACAG
GCGTTGTTGGCTATTATCCTCCTCCTTACGGACCACAGGCTGCGTGGGCTGGTGGCTACGATCCGCAACAGCAACAGCAG
CAGCAGCCGCCACCACAAGGACAAGGACATCGATGA