Details for Arabidopsis Locus AT3G14740

Position : Chr3 ( 5`- 4952004 .. 4953423 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14740

Protein [Map View]
MDAQYQDLPPLKRLRLLQRDLEAAQQHQLPNQPEMKSLQLPAKKRKQTRVDYDDDDAENSNPTYHCLPAKKRIWAIDPDL
LSGGGNPFSPFDLNVEYKPYVEEKSIEKKSTLNVESSLEVEEDDDKENIDPLGKGKALDLSDREVEDEDGIMCAVCQSTD
GDPLNPIVFCDGCDLMVHASCYGNPLVKAIPEGDWFCRQCLSSKNREKIFSCCLCTTKGGAMKPTNDGRWAHITCALFVP
EVYFEDPEGREGICCSEVLSKRWKDRCYLCKVRRGCVIECSEMRCKLAFHVTCGLKEDLCIEYREGKKSGGIVVGFCNEH
TKLWERQQESGKYKIVAREEDKK*

DNA
ATGGATGCTCAATATCAAGATCTACCTCCTCTCAAAAGATTAAGACTGTTGCAGAGAGATCTCGAAGCTGCTCAACAGCA
CCAGCTACCGAACCAACCGGAGATGAAGTCGTTGCAGTTGCCGGCAAAGAAGAGGAAGCAGACTCGTGTTGATTATGACG
ATGACGACGCAGAGAACTCCAATCCCACCTATCATTGTCTTCCGGCGAAGAAAAGGATCTGGGCGATTGATCCCGATCTT
CTCTCCGGTGGTGGTAACCCCTTTTCGCCTTTTGATCTAAATGTAGAGTATAAGCCTTATGTTGAAGAGAAATCAATTGA
GAAAAAGTCAACTCTAAATGTTGAATCTAGTCTAGAGGTAGAAGAAGATGATGATAAAGAGAATATAGATCCTCTAGGGA
AAGGAAAAGCTTTAGATCTCTCTGATAGAGAAGTAGAAGATGAAGATGGGATTATGTGTGCTGTATGTCAAAGTACAGAT
GGTGATCCATTGAATCCAATTGTGTTCTGTGATGGTTGTGATTTGATGGTTCATGCTTCTTGCTATGGGAATCCTCTTGT
TAAGGCTATTCCAGAAGGTGATTGGTTTTGTAGACAGTGTTTATCGTCGAAGAACCGAGAAAAGATCTTCTCTTGCTGCT
TGTGTACAACTAAAGGCGGGGCGATGAAACCTACGAATGATGGTAGATGGGCTCATATTACTTGTGCGTTGTTTGTTCCG
GAAGTTTACTTTGAGGATCCTGAAGGAAGAGAAGGGATTTGTTGTAGTGAGGTATTGAGTAAGAGATGGAAAGATAGGTG
TTATTTGTGTAAGGTTAGACGCGGTTGTGTTATTGAGTGTTCGGAGATGAGATGTAAGTTGGCTTTTCATGTTACTTGTG
GGTTAAAGGAAGATCTTTGTATTGAGTATCGTGAAGGGAAGAAGAGTGGTGGTATTGTTGTTGGTTTCTGTAATGAGCAT
ACCAAACTTTGGGAAAGGCAACAGGAAAGTGGAAAGTACAAGATTGTTGCCAGAGAAGAAGATAAAAAGTAG