Details for Arabidopsis Locus AT3G14730

Position : Chr3 ( 5`- 4949385 .. 4951346 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14730

Protein [Map View]
MTVSFLRIEIQNCSAGILRFLPRNPDLFAAIKPSSALASLYSTVSGQIEENPKRYEHHNVATCIATLQRCAQRKDYVSGQ
QIHGFMVRKGFLDDSPRAGTSLVNMYAKCGLMRRAVLVFGGSERDVFGYNALISGFVVNGSPLDAMETYREMRANGILPD
KYTFPSLLKGSDAMELSDVKKVHGLAFKLGFDSDCYVGSGLVTSYSKFMSVEDAQKVFDELPDRDDSVLWNALVNGYSQI
FRFEDALLVFSKMREEGVGVSRHTITSVLSAFTVSGDIDNGRSIHGLAVKTGSGSDIVVSNALIDMYGKSKWLEEANSIF
EAMDERDLFTWNSVLCVHDYCGDHDGTLALFERMLCSGIRPDIVTLTTVLPTCGRLASLRQGREIHGYMIVSGLLNRKSS
NEFIHNSLMDMYVKCGDLRDARMVFDSMRVKDSASWNIMINGYGVQSCGELALDMFSCMCRAGVKPDEITFVGLLQACSH
SGFLNEGRNFLAQMETVYNILPTSDHYACVIDMLGRADKLEEAYELAISKPICDNPVVWRSILSSCRLHGNKDLALVAGK
RLHELEPEHCGGYVLMSNVYVEAGKYEEVLDVRDAMRQQNVKKTPGCSWIVLKNGVHTFFTGNQTHPEFKSIHDWLSLVI
SHMHGHEYMTVDD*

DNA
ATGACCGTCTCGTTTCTACGGATCGAGATTCAAAATTGTTCTGCCGGAATTTTGAGATTTCTCCCACGGAACCCAGATTT
ATTCGCAGCTATAAAGCCTTCTTCTGCTTTAGCATCTTTATATTCGACTGTTTCTGGGCAAATCGAAGAAAACCCGAAGA
GATACGAGCACCACAATGTTGCTACATGTATCGCCACATTGCAACGCTGTGCACAGCGCAAAGATTACGTTTCCGGCCAA
CAGATCCACGGTTTCATGGTTAGAAAAGGGTTTCTGGATGATTCGCCACGCGCCGGCACGAGCCTCGTTAACATGTACGC
TAAGTGTGGTCTCATGCGGCGTGCGGTGTTGGTCTTTGGTGGATCCGAACGCGATGTATTTGGTTACAACGCTTTGATTT
CTGGGTTTGTGGTAAATGGGTCTCCTTTGGATGCGATGGAGACGTACAGAGAAATGAGAGCTAATGGGATTTTACCTGAT
AAGTATACATTTCCTAGTTTGCTAAAAGGAAGCGATGCTATGGAGCTTTCTGATGTTAAGAAGGTTCATGGATTGGCGTT
TAAACTTGGGTTTGATTCCGATTGTTATGTGGGGAGTGGCTTAGTTACTTCTTACTCGAAGTTCATGTCAGTGGAGGATG
CTCAGAAGGTGTTCGATGAATTGCCTGATAGAGATGACAGTGTGCTTTGGAATGCTTTAGTTAATGGGTATTCACAGATT
TTTAGATTTGAGGATGCTTTATTAGTCTTTAGTAAAATGCGTGAAGAAGGTGTAGGTGTGAGCAGGCATACCATTACAAG
CGTCTTATCAGCATTTACTGTTTCAGGGGATATTGACAACGGTAGGTCAATCCATGGCCTTGCGGTGAAAACGGGATCTG
GTTCTGATATTGTTGTGTCAAATGCATTGATTGATATGTATGGGAAGAGTAAATGGCTAGAAGAGGCAAACAGTATATTC
GAAGCAATGGATGAGAGAGACCTGTTTACATGGAACTCTGTTTTATGTGTTCATGACTACTGTGGTGATCATGATGGAAC
ATTAGCTCTTTTCGAAAGGATGCTTTGTTCTGGAATCCGACCTGATATTGTTACATTGACAACTGTTCTGCCCACCTGCG
GTCGTCTAGCTTCACTGAGGCAGGGCAGAGAGATTCATGGGTACATGATCGTCAGTGGACTTCTAAACCGCAAATCTAGT
AATGAATTTATACATAATTCTTTGATGGATATGTACGTGAAATGCGGGGACTTGAGGGACGCTCGGATGGTTTTCGACTC
AATGAGGGTTAAAGACTCAGCTTCTTGGAATATTATGATTAATGGCTATGGTGTGCAGAGCTGCGGTGAGTTAGCTTTGG
ATATGTTTTCATGTATGTGCAGAGCCGGTGTCAAACCCGATGAAATCACATTTGTTGGGTTGCTACAAGCGTGTAGCCAC
TCTGGTTTTTTGAACGAAGGGAGAAATTTTTTGGCACAGATGGAGACGGTATATAACATTCTCCCAACAAGTGATCACTA
CGCTTGTGTAATAGACATGCTTGGCCGTGCAGACAAGCTAGAGGAAGCATATGAGTTAGCAATATCAAAGCCCATTTGCG
ATAATCCTGTAGTCTGGCGGTCAATATTGTCATCTTGTCGTCTCCACGGGAACAAAGATCTCGCACTGGTGGCAGGAAAG
CGGCTACATGAGCTCGAGCCAGAGCATTGTGGCGGTTATGTATTAATGTCTAATGTTTATGTGGAAGCTGGGAAGTACGA
GGAAGTGTTGGACGTTAGAGACGCAATGAGACAACAGAATGTGAAGAAGACACCAGGTTGCAGCTGGATTGTGCTCAAGA
ACGGTGTTCACACGTTCTTTACCGGCAATCAGACTCACCCGGAATTTAAATCTATCCACGATTGGTTAAGCCTAGTGATT
TCTCATATGCACGGTCATGAGTATATGACGGTCGACGACTAA