Details for Arabidopsis Locus AT3G14710

Position : Chr3 ( 5`- 4941545 .. 4943055 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14710

Protein [Map View]
MHPETEQACLVPSSKKTKLCSENFEDKFSSLLESVVSIILSQLPTAEAVSTSVLSKSWKNIWTNITDLHFDDTKQRDPSD
SRFTDFVERVVGDIGSPHISSFYLCSVNTFDETLLFSWLSKVLKRNLQRLVVTCNDLEIISFSSLFPSFVSLVELRLRTK
SILDISAPAILPNLKFLSLEDARIFNMSSVSKNLVLNFPVLETFEASYCRCFRTDTVIIDSPLLRIFEMFKCTSEHVPNP
SQVCKIRVLASKLEKITFCGDEPRKIHLSFPPSLPDAYLALSRSEWPKTFLRSFTCVTSLALVLSKDFHVMAVPKFSQLV
YLHLIYDMTQHFRLMQFLKSAPILEMLSIRDLTSPRSTPTAKSLKELRSVESPDCVTTMLKVLQIRNFKPNRLQISVLRY
VLDNAEILGSVILSSPNPITEEEKARILAFPKASPHASVLFE*

DNA
ATGCATCCCGAGACAGAGCAAGCCTGTTTAGTTCCATCTTCCAAGAAGACTAAGCTATGCAGTGAGAACTTTGAAGACAA
ATTCAGCAGCTTGCTTGAGAGTGTTGTTAGCATAATTCTTAGTCAACTTCCAACTGCTGAAGCTGTTAGTACTTCTGTGT
TATCAAAGTCATGGAAGAACATTTGGACAAACATCACAGATTTACATTTTGATGATACAAAGCAGAGGGATCCGAGTGAT
TCTCGATTTACTGACTTCGTTGAGCGTGTGGTTGGCGACATTGGAAGTCCGCACATTAGCAGTTTCTATCTATGCTCTGT
TAATACTTTCGATGAGACTCTTCTCTTCTCGTGGTTATCAAAGGTACTAAAGCGCAATCTTCAGAGACTTGTTGTCACTT
GCAACGATCTAGAGATCATCAGTTTTTCTTCACTTTTTCCTAGTTTTGTTTCGCTTGTGGAGTTAAGGCTCCGTACAAAA
AGCATTCTTGACATTTCGGCTCCCGCTATTCTCCCGAACCTTAAGTTCCTTAGTCTCGAGGATGCTAGAATCTTCAACAT
GTCTTCTGTCTCAAAGAACCTCGTTCTGAACTTTCCTGTCTTGGAAACTTTTGAAGCCTCTTATTGCCGCTGCTTTAGAA
CCGATACTGTGATCATAGACTCTCCATTGCTTAGGATCTTTGAGATGTTCAAGTGTACATCTGAACACGTACCTAATCCT
TCTCAAGTGTGTAAGATCAGGGTGTTAGCTTCAAAGCTTGAGAAAATCACATTCTGTGGAGACGAACCCCGAAAAATCCA
TCTGTCTTTTCCACCGTCTTTACCTGATGCTTATCTTGCCCTCAGCAGATCCGAGTGGCCCAAGACGTTTCTACGTAGCT
TCACATGCGTGACGAGTTTGGCTCTCGTGCTTAGCAAGGATTTTCATGTGATGGCAGTACCCAAATTCAGCCAGTTGGTA
TACCTGCATTTGATATACGACATGACACAACATTTTAGATTAATGCAGTTCCTTAAATCCGCACCAATACTCGAGATGCT
CAGCATCCGCGACCTGACATCTCCTCGTTCAACACCTACTGCAAAGTCCTTGAAGGAACTACGTTCAGTAGAATCTCCGG
ATTGCGTTACAACAATGCTCAAAGTCCTGCAGATCAGGAACTTTAAGCCAAACAGGCTACAGATATCAGTGTTGAGGTAC
GTGTTGGACAATGCTGAGATTCTTGGATCAGTCATCCTTTCCTCGCCCAATCCAATCACAGAAGAAGAGAAAGCAAGAAT
CTTGGCTTTTCCTAAAGCCTCTCCCCATGCCTCTGTCTTGTTCGAATGA