Details for Arabidopsis Locus AT3G14600

Position : Chr3 ( 5`- 4910697 .. 4912173 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14600

Protein [Map View]
MGGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIW
LRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSKIKFPLVFRKVRP
PSRKLKTTYKASKPNLFM*

DNA
ATGGGTGGTTTCCGGTTTCACCAGTATCAGGTGGTTGGGAGAGCCCTCCCGACAGAGAACGATGAGCACCCTAAGATCTA
CAGGATGAAGCTTTGGGGTAGAAATGAAGTATGCGCCAAGTCCAAGTTCTGGTACTTCATGAGGAAACTGAAGAAGGTGA
AGAAAAGCAACGGACAGATGCTTGCCATCAATGAGATTTTCGAGAAGAACCCAACGACCATCAAGAACTACGGGATCTGG
TTGCGTTATCAGAGCCGAACTGGGTACCACAACATGTACAAGGAGTACCGTGACACAACACTCAATGGTGGAGTGGAGCA
GATGTACACTGAGATGGCTTCTCGTCATAGAGTGAGGTTCCCTTGCATTCAGATCATCAAGACTGCGACTGTCCCTGCAA
AGCTTTGCAAGAGAGAGATCACCAAGCAGTTCCATAACTCGAAGATCAAGTTCCCTCTTGTTTTCAGGAAGGTCAGACCA
CCAAGCAGGAAGCTTAAGACTACATACAAGGCATCAAAACCTAACCTTTTCATGTAG