Details for Arabidopsis Locus AT3G14590

Position : Chr3 ( 5`- 4904270 .. 4907993 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14590

Protein [Map View]
MECSVIHHVVIVLLLLWVLSYLNRSHAVFYVLSLVYLYLVHERYVMRLRKKLQFEERKQANQRRVLSDSESVRWLNHAVE
RIWPICMEQIASQKILRPIIPWFLDKYRPWTAKKVVIQHLYLGRNPPLLTDIRVLRQSTGDDHLVLELGMNFLTADDMSA
ILAVKLRKRLGFGMWTKLHLTGMHVEGKVLIGVKFLRRWPFLGRLRVCFAEPPYFQMTVKPITTHGLDVAVLPGIAGWLD
KLLSVAFEQTLVEPNMLVVDMEKFVSPESGDNWFFVDEKEPVAHALVEVVEACDVKPSDLNGLADPYVKGQLGAYRFKTK
ILWKTLAPKWQEEFKIPICTWDSANILNIEVQDKDRFSDDSLGDCSVNIAEFRGGQRNDMWLPLQNIKMGRLHLAITVLE
DEAKLNDDPFEGVTICKEDMWASFASDVTNKGSFSSVVSDKSPRVPDNMEPINIEGQEETGIWVHQPGTEVSQIWEPRKG
KSRCLDNKIQCAGSVRSTASTSPNNESSSTDKNQEGKSEMKSVGWGLKKIGLVFHKNGKKEECHHTGSIEEDIRSPRINL
KALNQKDVGVKFIVEDRLSGPLTGRSPKGESFDSEDSQHKRHMKDVAKSILKHAEKSARHLKHAFSHKGSRKSRDDECST
VSEQDSECLSETSDDKSAFSNVQDLGTLRRAKLEGKTVKAGEDDNVNTSANSKDDSKNKETKKNLANLETTYSDARNSFA
GAEKVTTPKNRKGIIGK*

DNA
ATGGAGTGTTCGGTAATCCATCATGTGGTGATTGTGTTACTGTTACTTTGGGTTCTATCTTACTTGAATCGATCACACGC
GGTTTTCTATGTCCTCTCTCTCGTTTATCTTTACCTGGTTCATGAACGCTATGTGATGAGATTGAGGAAGAAATTGCAGT
TTGAAGAGAGGAAGCAAGCTAACCAGAGACGTGTTCTATCTGATTCTGAATCGGTGCGGTGGTTGAATCATGCCGTGGAG
AGGATATGGCCTATTTGTATGGAACAGATTGCTTCTCAGAAGATTCTTCGTCCGATCATACCTTGGTTCTTGGACAAGTA
TAGACCTTGGACTGCGAAAAAAGTTGTGATACAACACCTTTATTTGGGAAGAAACCCTCCTTTGTTGACAGATATTAGGG
TTCTACGGCAATCTACGGGTGATGATCACTTGGTACTGGAACTTGGAATGAATTTCCTCACAGCAGATGATATGAGCGCA
ATACTCGCTGTGAAGTTAAGAAAAAGACTTGGGTTTGGAATGTGGACAAAGTTGCATTTGACAGGAATGCATGTTGAAGG
AAAGGTGTTGATTGGAGTGAAGTTCCTTCGTCGATGGCCTTTTCTCGGGCGTTTACGAGTGTGTTTTGCAGAGCCACCTT
ATTTCCAAATGACTGTTAAACCAATTACCACTCATGGACTTGATGTTGCTGTGCTTCCAGGGATTGCAGGATGGCTAGAC
AAACTTTTGTCTGTTGCATTTGAGCAGACTCTTGTTGAGCCAAATATGCTGGTAGTTGATATGGAGAAATTTGTTAGCCC
AGAGTCAGGAGATAATTGGTTCTTTGTTGATGAGAAAGAACCAGTAGCACACGCTCTTGTTGAAGTCGTTGAAGCATGTG
ATGTTAAACCATCAGATCTAAACGGTTTAGCTGATCCTTACGTGAAAGGGCAGCTTGGCGCTTACAGATTCAAAACCAAG
ATACTATGGAAAACCTTGGCTCCCAAATGGCAAGAAGAGTTCAAGATACCAATCTGCACATGGGACTCCGCAAATATTCT
TAACATTGAAGTTCAAGACAAAGACCGATTTAGCGATGACAGTCTTGGCGACTGTTCAGTGAACATTGCAGAGTTTCGAG
GCGGCCAAAGAAATGATATGTGGTTGCCTCTTCAGAACATTAAAATGGGGAGATTGCACCTTGCTATAACCGTACTTGAG
GACGAGGCAAAGTTGAACGATGATCCGTTTGAAGGAGTGACAATATGTAAGGAAGACATGTGGGCTTCTTTTGCTTCCGA
CGTTACAAATAAAGGTTCCTTCTCATCAGTGGTATCTGACAAGTCTCCAAGGGTTCCTGATAATATGGAACCAATAAACA
TCGAAGGACAAGAAGAGACTGGGATTTGGGTACATCAACCAGGAACTGAAGTCTCACAGATTTGGGAACCAAGAAAAGGC
AAGAGTCGATGCCTTGATAACAAAATACAGTGCGCTGGCAGTGTCCGTTCCACTGCATCTACGTCGCCCAACAATGAAAG
CAGCAGCACTGATAAAAATCAGGAAGGGAAGAGCGAGATGAAGTCTGTTGGTTGGGGGCTGAAGAAAATCGGTTTAGTGT
TCCATAAGAATGGAAAAAAGGAAGAATGTCATCATACAGGGAGCATTGAAGAGGATATCAGGTCTCCTCGGATTAATTTG
AAGGCGTTAAATCAAAAGGATGTTGGAGTTAAGTTCATCGTTGAAGACAGGCTATCGGGGCCTCTCACAGGAAGAAGTCC
AAAAGGTGAGAGCTTTGATTCTGAAGACAGTCAGCACAAGAGACACATGAAGGATGTTGCAAAAAGCATTCTAAAACATG
CTGAAAAGTCTGCAAGACACCTTAAGCATGCTTTTTCGCATAAAGGATCAAGGAAATCAAGAGATGACGAGTGTTCAACT
GTGTCAGAGCAAGACTCTGAATGTCTAAGTGAAACTTCTGATGACAAATCTGCATTTAGCAATGTGCAGGACCTGGGGAC
ACTAAGAAGAGCAAAACTTGAAGGAAAGACTGTCAAGGCAGGTGAAGATGATAATGTAAATACATCCGCGAACTCCAAAG
ACGATTCGAAAAACAAGGAAACAAAGAAAAATTTAGCAAACTTGGAAACTACATATAGTGATGCCAGGAACTCTTTTGCT
GGAGCCGAGAAAGTCACCACCCCCAAGAATCGAAAAGGAATCATAGGTAAATAA