Details for Arabidopsis Locus AT3G14580

Position : Chr3 ( 5`- 4903012 .. 4904229 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14580

Protein [Map View]
MILRRLVLSATSNSNPRRSQSLSSSGVRILSSSSSDRYTSSSQRYSGDDRLARLRHKDWLAPNEVLKIFDNVKDPSFLLP
AYQHYSKRKDYQPTESLYALMINKFGQAKMYDEIEEVMRTIKLEKRCRFSEEFFYNLMRIYGNLAGRINRAIEILFGMPD
FGCWPSSKSFNFILNLLVSAKLFDEIHKIFVSAPKLGVEIDACCLNILIKGLCESGNLEAALQLLDEFPQQKSRPNVMTF
SPLIRGFCNKGKFEEAFKLLERMEKERIEPDTITFNILISGLRKKGRVEEGIDLLERMKVKGCEPNPGTYQEVLYGLLDK
KRNLEAKEMMSQMISWGMRPSFLSYKKMVLGLCETKSVVEMDWVLRQMVNHGFVPKTLMWWKVVQCVVSKNNDDSQANLD
RITAC*

DNA
ATGATTCTTCGGAGGCTTGTTCTGTCTGCAACATCGAATTCAAATCCCAGAAGAAGCCAATCACTTTCATCTTCTGGTGT
TCGTATTCTCTCATCATCATCTTCAGATAGATATACGTCGTCCTCGCAACGATATTCCGGTGACGATAGACTCGCCAGGC
TAAGGCACAAGGACTGGTTAGCCCCAAACGAAGTTTTGAAAATCTTCGACAATGTCAAAGATCCGAGCTTCCTGCTGCCA
GCTTACCAGCATTACTCTAAACGGAAAGACTATCAACCAACGGAATCTCTCTACGCCCTTATGATCAACAAGTTTGGCCA
AGCTAAAATGTACGATGAAATCGAAGAAGTAATGAGAACTATAAAGCTTGAGAAAAGATGTCGTTTCTCAGAGGAGTTTT
TCTACAATTTGATGAGGATTTACGGGAACTTAGCCGGAAGAATCAACCGAGCGATCGAGATATTGTTCGGTATGCCGGAT
TTTGGATGCTGGCCAAGTTCTAAGAGTTTCAATTTCATACTGAATTTACTTGTTTCCGCGAAGTTGTTCGATGAGATTCA
TAAGATCTTTGTGAGTGCTCCTAAGCTAGGTGTTGAGATCGATGCTTGTTGCTTGAATATACTCATCAAAGGACTCTGTG
AGAGTGGGAATTTAGAAGCTGCACTCCAACTGCTCGACGAATTTCCTCAACAAAAATCACGGCCTAATGTGATGACGTTT
TCTCCTTTGATTCGTGGTTTCTGTAATAAGGGAAAGTTCGAAGAAGCTTTTAAATTGTTGGAGAGGATGGAGAAGGAACG
AATCGAACCAGATACTATCACGTTTAACATTTTGATTTCAGGGCTTAGGAAGAAAGGTAGAGTTGAAGAAGGGATTGATC
TTTTAGAGAGAATGAAGGTAAAGGGGTGTGAACCAAATCCTGGGACTTATCAGGAGGTGTTGTATGGTCTCTTGGATAAA
AAGAGGAACTTGGAAGCTAAAGAGATGATGAGTCAGATGATTTCATGGGGTATGAGACCCAGTTTTCTGTCTTACAAGAA
GATGGTTTTGGGGCTTTGTGAAACGAAGTCGGTTGTGGAAATGGACTGGGTTTTGAGGCAAATGGTGAATCATGGTTTTG
TTCCAAAGACATTGATGTGGTGGAAAGTTGTTCAGTGTGTTGTTTCAAAGAACAATGATGACTCTCAAGCAAATTTGGAT
CGTATTACTGCTTGCTAG