Details for Arabidopsis Locus AT3G14490

Position : Chr3 ( 5`- 4863631 .. 4865949 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14490

Protein [Map View]
MEATRTSFGLHNAPLCPTTNPSLFPRRWLHKHTLSLKPAKQHHLVCVRATESNDNLESSRPLAHFSPTLWGDHFLSVPLH
VAEFDDFSREIEVTMKPKVRDMLKSSKNSDNERIRLIHLLMNLGIAYHFEIEIDEILGQAFGNLDDIIAKENDLETISTM
FEVFRLRGYYMPCYAFNRFKGEDGRFKESLAEDIRGMLQLYEAAHLGTPSEDIMDEALSFTRYRLESLTSNHTATASPHL
SKHIQNALYRARYHNLEILVAREYISFYEQEEDHDETLLKFAKLNFNYCQLHYIQELKDLTKWWKELDLASKLPYIRDRI
VEVYFGALALYFEPRYSLGRIIVTKITMIVTVFNDTCDAYGTLPEVTSLVDSFQRWDLGDIEKLPSYVKIVFRGVFETLE
EIEQEMRPQGRSRIVQVAVDEIKKLGKAYLAISKWARASHVPTFEEYMEFGMQTSMDHFAAYSFIAMEDCDENQTCEWYK
SRPKMMEALNGVFRIKNDINTFEQEMSRGEVAKGLNCYMKQHGVSKEEAIGEMNKIYSNYYKIIMEEYLTTTAVPRPILV
RCLNVSRPIHHFYKERDEFTDPYFGMLKEVITSLFIHPIPL*

DNA
ATGGAAGCAACAAGAACGAGTTTTGGTCTTCATAACGCCCCTCTCTGCCCCACAACAAACCCCTCTCTTTTTCCTCGGCG
TTGGCTTCACAAGCACACTCTTTCCTTGAAACCGGCAAAACAACACCACTTGGTCTGCGTTAGGGCTACTGAGAGTAATG
ATAATCTTGAAAGTAGTCGTCCCTTGGCACACTTTTCTCCCACTCTTTGGGGAGATCACTTCCTTTCTGTTCCCCTCCAT
GTCGCTGAATTTGATGATTTCTCAAGAGAGATTGAAGTGACGATGAAGCCAAAAGTGAGAGACATGCTCAAGTCTTCCAA
AAACAGCGACAATGAGAGGATCCGTCTCATCCATTTGCTAATGAACCTCGGAATCGCATATCATTTCGAGATTGAGATTG
ATGAGATTCTTGGCCAAGCTTTTGGGAATTTGGACGATATAATAGCCAAGGAAAATGATTTGGAAACAATCTCCACCATG
TTTGAGGTTTTCAGACTACGCGGTTACTATATGCCTTGCTATGCATTCAATAGATTCAAAGGTGAAGATGGGAGGTTCAA
GGAAAGTCTAGCTGAGGATATTAGAGGAATGCTACAGTTGTACGAAGCAGCACATCTCGGGACACCATCTGAAGATATTA
TGGACGAAGCATTGAGCTTCACTCGGTATCGCTTAGAGTCGTTGACAAGTAATCACACAGCAACTGCTAGTCCCCATCTC
TCTAAACATATACAAAACGCACTATATAGAGCTCGATATCATAACTTGGAGATATTAGTCGCAAGAGAATATATCTCTTT
CTACGAACAAGAAGAAGATCATGACGAGACGCTGCTCAAGTTTGCAAAACTCAACTTCAACTATTGCCAGCTACATTATA
TCCAAGAGCTAAAAGATCTGACCAAATGGTGGAAGGAGCTAGATCTTGCATCTAAGCTGCCTTACATCAGGGACAGAATT
GTAGAGGTCTACTTTGGGGCACTCGCATTGTATTTTGAGCCACGGTATTCACTAGGGAGAATTATAGTCACTAAAATTAC
CATGATTGTGACTGTTTTTAATGATACATGTGATGCATATGGTACTCTTCCTGAAGTTACAAGCCTCGTTGATTCTTTCC
AAAGGTGGGATCTTGGGGACATAGAAAAGCTACCAAGTTATGTAAAAATCGTCTTTCGAGGTGTATTTGAAACTTTAGAA
GAGATTGAACAAGAAATGAGGCCACAGGGAAGGTCACGCATTGTGCAAGTAGCGGTAGATGAGATCAAGAAGTTGGGGAA
AGCATACTTGGCTATCTCGAAATGGGCACGCGCAAGTCACGTGCCAACCTTTGAGGAGTACATGGAGTTTGGTATGCAGA
CGTCAATGGATCATTTTGCAGCCTATAGCTTTATCGCGATGGAAGATTGTGATGAGAATCAAACGTGCGAGTGGTACAAA
TCCAGACCTAAAATGATGGAAGCTCTGAATGGTGTGTTTCGTATTAAGAACGACATAAACACCTTTGAGCAAGAGATGAG
CAGAGGAGAAGTGGCTAAAGGGCTGAATTGTTACATGAAGCAACATGGTGTTTCCAAAGAAGAGGCGATTGGAGAGATGA
ACAAGATTTATAGTAATTATTACAAAATAATAATGGAGGAGTACTTGACGACAACCGCTGTGCCACGTCCGATTCTGGTG
CGATGCCTCAACGTTTCACGACCCATCCATCATTTTTACAAGGAGAGAGATGAATTCACAGATCCTTATTTCGGAATGCT
TAAAGAAGTCATCACTTCTTTGTTCATCCATCCAATTCCTCTTTGA