Details for Arabidopsis Locus AT3G14450

Position : Chr3 ( 5`- 4849788 .. 4851601 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14450

Protein [Map View]
MATVTEMPTDVVVVDDVKEVSTKSEKIIDEGIEKSSITDSKTETESRLDMHKLVAMFKKLNPLAKEFFPSYYDPKKNNQV
AKANQFLPADDFETTKKQSGEEFDLDAKKDDNTRKRRNYSQGRRRLTGRISKAQREDSIRRTVYVSDIDQSVTEEGLAGL
FSNCGQVVDCRICGDPHSVLRFAFVEFADDQGAHEALSLGGTMLGFYPVRVLPSKTAILPVNPTFLPRSEDEREMCTRTI
YCTNIDKKVSQADVRNFFESACGEVTRLRLLGDQLHSTRIAFVEFALADSALSALNCSGMVVGSQPIRVSPSKTPVRPRI
TRPPSTN*

DNA
ATGGCTACGGTCACTGAGATGCCCACTGATGTTGTTGTTGTCGACGATGTTAAGGAAGTTAGTACCAAAAGCGAAAAGAT
CATCGATGAGGGAATTGAGAAGAGCTCGATCACGGATTCTAAAACCGAAACTGAATCTCGGCTTGATATGCACAAGCTTG
TGGCTATGTTCAAGAAACTGAATCCTTTGGCCAAGGAGTTTTTCCCTTCTTACTACGATCCGAAGAAGAACAATCAGGTA
GCTAAGGCTAACCAATTTCTGCCGGCTGACGATTTTGAGACCACCAAGAAGCAATCTGGTGAAGAATTTGATCTTGATGC
CAAGAAGGATGACAATACCCGCAAGAGAAGAAACTATAGCCAAGGGAGAAGGAGGTTAACTGGAAGAATTTCTAAGGCTC
AAAGAGAGGATAGTATTAGAAGAACAGTTTATGTTTCTGACATTGACCAGAGTGTGACTGAGGAGGGTCTTGCTGGCTTG
TTTAGTAACTGTGGACAAGTTGTTGACTGTAGAATTTGTGGCGATCCACATTCGGTTCTTCGATTTGCGTTTGTTGAGTT
TGCTGATGACCAGGGCGCACATGAAGCTTTAAGCCTTGGTGGAACAATGCTCGGGTTCTACCCGGTGAGGGTCTTACCCT
CAAAAACTGCCATCCTACCAGTGAATCCCACATTTCTTCCAAGGTCAGAAGATGAAAGGGAGATGTGCACAAGGACAATC
TATTGCACCAACATCGACAAGAAAGTTTCTCAAGCTGATGTGAGAAACTTCTTTGAATCTGCATGTGGTGAGGTAACTCG
TCTGAGGCTTCTTGGCGATCAATTGCATTCAACTCGCATAGCTTTTGTTGAATTTGCTCTGGCAGATAGTGCACTTAGCG
CGCTCAATTGCAGCGGAATGGTCGTTGGATCACAACCGATAAGGGTAAGTCCATCAAAGACACCAGTGAGGCCAAGAATC
ACTCGACCACCATCGACAAACTAG