Details for Arabidopsis Locus AT3G14430

Position : Chr3 ( 5`- 4824196 .. 4824837 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14430

Protein [Map View]
MIGRRAGTNRVGMRRDDSLLTRFVDSVFYFFRLAEFEILFVLFMLITYVIFKDLTSRPEYNRILVEKPGGSDIWPF*

DNA
ATGATCGGGCGACGTGCTGGAACTAATCGAGTCGGTATGAGGAGAGACGACTCTCTTCTGACTCGGTTTGTTGACTCAGT
GTTCTATTTCTTCCGATTAGCTGAGTTTGAGATCCTGTTTGTGCTCTTCATGCTTATTACCTACGTTATTTTCAAAGATC
TGACGTCGAGGCCGGAGTATAATCGGATTCTTGTGGAGAAACCCGGTGGATCTGACATCTGGCCGTTTTAA