Details for Arabidopsis Locus AT3G14410

Position : Chr3 ( 5`- 4815811 .. 4817980 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14410

Protein [Map View]
MADRSKGFMRAEFVTYAYILLYIALSSGQIFFNKWVLSSKEINFPYPLGLTLLHMIFSSVLCFLLTKVLKIVKVEEGMTL
EIYVTSVIPIGAMFAMTLWLGNTAYLYISVAFAQMLKAIMPVAVFILGVAAGLEMMSCRMLLIMSIISFGVLVASYGELN
INWIGVVYQMGGVVGEALRLIFMELLVKRKGIKLNPISLMYYVSPCSAICLFVPWIFLEKSKIDGNGPWNFHFVVLTLNS
LCTFALNLSVFLVISHTSALTIRVAGVVKDWVVVLVSALLFADTKLTIINLFGYAIAIAGVAAYNNHKLKKEASKVVTTE
TPGDAESIPLVSQGNTNTER*

DNA
ATGGCGGATCGGAGCAAAGGCTTTATGAGAGCTGAATTCGTGACCTATGCTTACATTCTTCTCTATATCGCTCTTTCTAG
TGGTCAAATCTTCTTCAATAAGTGGGTTTTGTCATCTAAGGAAATTAATTTCCCTTATCCTCTTGGATTGACTTTACTCC
ATATGATCTTTTCCTCTGTCTTGTGCTTTCTTCTTACCAAAGTTCTTAAGATTGTGAAGGTCGAGGAAGGAATGACACTA
GAAATATATGTTACGTCAGTTATTCCAATAGGTGCAATGTTTGCAATGACCCTCTGGTTGGGAAACACTGCCTACCTCTA
CATATCAGTTGCATTTGCGCAGATGTTGAAGGCTATAATGCCTGTTGCTGTGTTTATTCTTGGAGTAGCTGCTGGACTTG
AAATGATGAGCTGCAGGATGCTTTTGATAATGTCTATCATAAGTTTTGGTGTTTTAGTAGCTTCTTATGGGGAATTAAAC
ATCAACTGGATTGGAGTGGTTTACCAAATGGGTGGTGTTGTTGGAGAAGCCCTGAGGCTAATCTTCATGGAACTTCTTGT
CAAGAGGAAGGGCATCAAGTTAAACCCAATCTCTCTTATGTACTACGTGAGCCCATGCAGTGCTATCTGCTTGTTTGTGC
CGTGGATCTTTCTAGAGAAATCGAAGATAGATGGCAATGGCCCATGGAACTTCCACTTTGTAGTGTTGACCCTTAATTCC
CTCTGTACATTTGCCCTCAACTTGTCGGTTTTCTTGGTGATTTCTCACACGAGTGCTCTCACTATCCGAGTTGCTGGCGT
TGTCAAGGATTGGGTGGTTGTCTTGGTGTCAGCTCTTCTCTTTGCCGACACGAAACTCACAATCATCAATCTTTTCGGTT
ACGCCATCGCTATTGCCGGTGTAGCGGCTTATAACAACCATAAGCTGAAGAAGGAAGCATCCAAAGTTGTTACCACAGAA
ACTCCAGGAGATGCTGAATCAATACCGTTGGTGTCACAAGGTAATACTAATACAGAGAGATGA