Details for Arabidopsis Locus AT3G14400

Position : Chr3 ( 5`- 4811532 .. 4815515 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14400

Protein [Map View]
MGFKLQMSWMPSLLSQKRRNGPPLGLRNLGNTCYLNSVLQCLTFTPPLANFCLTHKHSSHCDTYVDGERKRDCPFCIVEK
RIARSLSVDLTTDAPNKISSCLKIFAEHFKLGRQEDAHEFLRYVIDACHNTSLRLKKLRYNGNEPFNGNSVVKEIFGGAL
QSQVKCLSCGAESNKADEIMDISLEILQSSSVKESLQKFFQSEILDGNNKYRCESCEKLVTARKQMSILQAPNILVIQLK
RFGGIFGGKIDKAISFGEILVLSNFMSKASKDPQPEYKLFGIIVHSGFSPESGHYYAYVKDSLGRWYCCNDSFVSLSTLQ
EVLSEKAYILFFSRSNQRPASAKTLVTSNGTTSHEVNGCETSNPQKFIGPLNGFNMKPQAEQSFQKGNLASSKPHKFIRP
KPRAEQAPLEDNLLSSKVEKAPLRPHAKVSISVNLGAKRVSPVNGRLSFHQDENIAPKANKENSVSVLPTKVNSGTERKF
GTENGGNGVKENGSAPGSSNHKVALHPHERSNGSSNGGDHHKDNLHPCGSNGSQNGTAHPETERNGVSTTQSKGLCSSTK
EDPCILLRKDESSRNELEAIKESLKKDALSHLRSCGWYDKVLISMHAKKRLRTEQSGGEDGSDLKRRLIEDVKSSLKSQI
PEELKADLVNRIWEISKKKYS*

DNA
ATGGGATTTAAACTGCAGATGAGCTGGATGCCGAGTCTACTGAGTCAAAAGCGTAGGAATGGTCCTCCCTTAGGGTTACG
GAATCTCGGCAACACCTGTTACCTCAATAGTGTCCTTCAGTGTCTCACTTTCACTCCTCCTCTCGCTAATTTCTGCCTTA
CTCACAAACACTCCTCTCACTGCGACACATATGTGGATGGAGAGAGGAAAAGGGATTGTCCATTTTGCATAGTTGAGAAA
AGAATAGCAAGGTCTCTTAGTGTGGATCTAACTACCGATGCGCCTAACAAGATTTCAAGCTGTCTCAAAATTTTTGCTGA
GCATTTTAAGCTTGGTCGTCAAGAGGATGCTCATGAGTTCTTGCGCTATGTCATTGATGCATGCCACAATACGTCTCTCA
GACTCAAGAAGTTGCGATACAACGGTAACGAGCCCTTTAATGGCAATAGTGTCGTGAAGGAGATTTTTGGTGGTGCTTTG
CAGAGCCAGGTCAAGTGTTTGTCTTGTGGTGCGGAGTCTAATAAAGCCGATGAGATTATGGATATCAGTCTTGAGATTTT
GCAGAGTAGCTCTGTGAAGGAGTCATTGCAAAAGTTCTTTCAATCAGAGATTTTAGATGGCAACAATAAGTATAGATGCG
AGTCCTGTGAAAAACTGGTGACGGCGAGGAAGCAGATGTCTATACTGCAAGCGCCTAATATCCTTGTTATCCAATTGAAA
AGGTTTGGGGGCATTTTTGGTGGGAAGATTGATAAAGCCATTTCATTTGGTGAGATTCTGGTTCTCTCGAACTTCATGAG
TAAAGCAAGCAAGGACCCTCAACCGGAATACAAGCTCTTTGGGATAATTGTGCACTCAGGATTTTCTCCTGAATCTGGGC
ACTATTATGCATACGTTAAGGATTCCTTGGGTCGATGGTATTGCTGCAATGATTCGTTTGTCTCGCTCTCCACCTTGCAG
GAGGTTTTATCAGAGAAAGCTTATATCCTGTTTTTCAGCCGTTCAAACCAGAGGCCAGCGTCTGCTAAAACTCTGGTAAC
ATCCAATGGGACTACATCTCATGAAGTTAATGGCTGTGAGACATCAAATCCCCAGAAGTTTATTGGGCCCCTTAATGGTT
TCAACATGAAACCTCAAGCCGAGCAGTCCTTCCAGAAGGGTAACCTGGCTTCTTCAAAGCCCCATAAATTTATTAGGCCC
AAACCACGAGCCGAGCAGGCCCCACTAGAGGATAACCTGCTTTCTTCCAAAGTTGAAAAGGCGCCTTTAAGGCCACATGC
GAAAGTCAGTATATCTGTCAACCTTGGTGCCAAAAGGGTCTCTCCTGTCAATGGTAGACTTTCTTTCCACCAAGATGAGA
ACATAGCTCCAAAGGCAAACAAAGAGAATAGTGTATCAGTTTTGCCGACTAAAGTTAACTCTGGTACGGAGAGAAAGTTT
GGTACTGAAAATGGTGGCAATGGAGTTAAAGAAAACGGCAGTGCACCAGGTAGTAGTAATCATAAAGTGGCATTGCATCC
TCATGAGCGGAGTAATGGCTCCAGCAATGGGGGTGATCACCACAAGGATAACTTACATCCATGTGGAAGTAATGGCTCAC
AAAATGGAACTGCTCACCCCGAAACTGAGAGGAACGGTGTTAGTACCACCCAATCCAAAGGCTTGTGTTCTTCAACAAAG
GAAGACCCCTGCATTTTGCTGAGAAAAGACGAATCATCTCGGAATGAACTTGAAGCAATAAAAGAGAGCCTGAAAAAAGA
CGCGCTGTCACATCTACGTTCATGCGGATGGTATGACAAGGTTCTCATCTCCATGCATGCCAAGAAGAGATTGCGTACAG
AGCAATCAGGTGGAGAAGATGGTAGCGACTTGAAAAGGAGGTTGATTGAAGATGTGAAATCAAGTTTGAAATCACAGATT
CCAGAGGAGTTGAAAGCAGATCTGGTAAATCGTATCTGGGAGATTAGCAAGAAGAAGTACTCGTGA