Details for Arabidopsis Locus AT3G14395

Position : Chr3 ( 5`- 4810923 .. 4811481 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14395

Protein [Map View]
METVKTSRFTTEVAPAKFISATREPFKNMLTTISEEDFDFDELVRATAERLSSSCPGSSSWSLAHYAKINRVSSS*

DNA
ATGGAAACAGTTAAGACCTCCAGGTTCACTACTGAGGTGGCTCCGGCTAAGTTTATATCGGCGACAAGAGAACCATTCAA
GAACATGTTGACAACAATCTCCGAGGAAGACTTTGACTTTGATGAACTAGTCAGAGCCACTGCAGAGAGACTCTCTTCTT
CTTGTCCAGGCTCCTCCTCCTGGTCTCTTGCTCACTACGCCAAGATCAACAGAGTCTCTTCTTCTTAG