Details for Arabidopsis Locus AT3G14390

Position : Chr3 ( 5`- 4806725 .. 4809433 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14390

Protein [Map View]
MAAATQFLSQPSSLNPHQLKNQTSQRSRSIPVLSLKSTLKPLKRLSVKAAVVSQNSSKTVTKFDHCFKKSSDGFLYCEGT
KVEDIMESVERRPFYLYSKPQITRNLEAYKEALEGVSSVIGYAIKANNNLKILEHLRSLGCGAVLVSGNELRLALRAGFD
PTKCIFNGNGKSLEDLVLAAQEGVFVNVDSEFDLNNIVEASRISGKQVNVLLRINPDVDPQVHPYVATGNKNSKFGIRNE
KLQWFLDQVKAHPKELKLVGAHCHLGSTITKVDIFRDAAVLMIEYIDEIRRQGFEVSYLNIGGGLGIDYYHAGAVLPTPM
DLINTVRELVLSRDLNLIIEPGRSLIANTCCFVNHVTGVKTNGTKNFIVIDGSMAELIRPSLYDAYQHIELVSPPPAEAE
VTKFDVVGPVCESADFLGKDRELPTPPQGAGLVVHDAGAYCMSMASTYNLKMRPPEYWVEEDGSITKIRHAETFDDHLRF
FEGL*

DNA
ATGGCGGCAGCTACTCAATTTCTCTCCCAACCTTCGTCTCTCAATCCACACCAACTGAAGAACCAAACCTCACAACGCTC
CAGAAGCATCCCTGTCTTGTCTCTTAAATCCACATTGAAGCCACTTAAACGCCTCTCCGTGAAAGCCGCCGTCGTTTCTC
AAAACTCGTCCAAAACCGTGACGAAGTTCGATCACTGTTTCAAGAAATCATCAGATGGGTTTCTCTATTGTGAAGGAACT
AAAGTTGAGGATATCATGGAGTCAGTGGAGAGAAGACCCTTTTACTTATATAGCAAACCTCAGATCACTAGAAACCTCGA
GGCTTATAAAGAAGCATTGGAAGGAGTGAGCTCTGTGATTGGTTACGCTATCAAAGCTAATAACAATCTTAAAATTTTGG
AGCATTTGAGAAGTTTAGGCTGTGGTGCTGTGCTCGTTAGTGGAAATGAGCTTAGACTTGCTCTTCGTGCTGGTTTCGAT
CCCACAAAGTGCATTTTCAATGGAAATGGCAAGTCTTTGGAAGATTTAGTTCTAGCTGCTCAAGAAGGTGTTTTCGTTAA
TGTCGATAGTGAGTTTGACTTGAATAACATTGTGGAAGCTTCAAGAATTTCTGGTAAGCAGGTCAATGTACTGCTGCGTA
TCAATCCTGATGTTGATCCTCAGGTGCATCCATATGTTGCTACTGGGAACAAGAACTCAAAGTTTGGTATCAGGAACGAG
AAGCTTCAATGGTTTCTGGATCAGGTCAAGGCACATCCCAAAGAGCTGAAGCTTGTTGGAGCTCATTGCCATCTAGGCTC
TACCATTACTAAGGTGGATATATTCAGAGATGCGGCAGTTCTCATGATAGAATACATTGACGAGATCCGGCGTCAAGGTT
TTGAAGTTAGTTACTTGAACATTGGTGGTGGTTTAGGGATTGATTATTACCATGCCGGCGCTGTCCTTCCCACACCCATG
GATCTCATCAACACTGTAAGAGAGCTTGTTCTTTCACGAGACCTGAATCTAATAATCGAGCCAGGGAGATCTCTGATTGC
AAACACTTGCTGTTTCGTCAACCATGTAACTGGTGTGAAGACGAATGGAACTAAGAACTTCATAGTCATTGATGGAAGTA
TGGCTGAGCTTATCCGTCCCAGTCTTTATGATGCTTATCAGCACATTGAGTTGGTCTCTCCTCCACCGGCTGAAGCAGAG
GTTACCAAATTCGACGTAGTGGGTCCTGTCTGTGAATCTGCTGATTTCCTGGGCAAAGACAGAGAGCTTCCCACTCCTCC
ACAGGGAGCTGGTCTGGTGGTTCATGACGCTGGTGCATACTGTATGAGCATGGCTTCCACTTACAATCTCAAGATGCGTC
CTCCGGAATACTGGGTTGAAGAAGATGGGTCGATCACTAAGATAAGGCATGCTGAGACATTCGATGACCATTTGCGTTTC
TTTGAAGGTCTATGA