Details for Arabidopsis Locus AT3G14380

Position : Chr3 ( 5`- 4802952 .. 4803811 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14380

Protein [Map View]
MDKTDQTAIDESALVLNRTEKSAEAVLRVASMALSITGLVIMIKNSISNEFGSVSYSNIGAFMYLVSANGVCAAYSLLSA
LAILALPCPISKVQVRTLFLLDQVVTYVVLAAGAVSAETVYLAYYGNIPITWSSACDSYGSFCHNALISVVFTFVVSLLY
MLLSLISSYRLFTRFEAP*

DNA
ATGGACAAGACTGATCAAACCGCCATTGACGAATCAGCTTTAGTGCTTAATCGCACTGAGAAATCGGCAGAGGCGGTCCT
GCGAGTAGCATCAATGGCTCTAAGTATTACGGGTCTCGTCATCATGATCAAGAACTCTATCTCCAACGAATTTGGCTCTG
TTTCTTACTCAAATATTGGAGCTTTCATGTATTTGGTGAGTGCTAATGGCGTTTGTGCTGCTTATTCTCTTCTCTCGGCT
CTCGCAATATTAGCGCTTCCGTGTCCAATAAGCAAGGTCCAAGTCAGGACATTGTTCTTGCTTGACCAGGTGGTCACATA
CGTGGTTCTAGCGGCTGGGGCTGTATCTGCAGAGACGGTTTACTTAGCATACTATGGAAACATACCCATTACTTGGAGCT
CTGCTTGTGACTCCTATGGATCCTTCTGTCATAATGCATTGATTTCGGTTGTTTTCACATTCGTTGTCTCCCTTCTCTAC
ATGTTGCTCTCGCTTATCTCTTCCTATCGACTCTTCACCAGATTTGAAGCACCCTAA