Details for Arabidopsis Locus AT3G14370

Position : Chr3 ( 5`- 4797845 .. 4799504 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14370

Protein [Map View]
MEQEDFYFPDTDLDLSFTSTTTDRTFASSSARTSLTLSFNDRLSTSSAVTTSSTSSSSVNHRRHDPHWSAIKSAKLLSSD
GNIHLRHLKLIRHLGTGNLGRVFLCNLRDSSARFALKVIDRNCLTTEKKLSQVETEAEILSLLDHPFLPTLYARIDESHY
TCLLIDYAPNGDLHSLLRKQPGNRLPIQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLSDFDLCFKSDV
VPTFKSRRYRRSSSSPSLRRRRSGCFSVAAEKKYEREEIVSEFAAEPVTAFSRSCVGTHEYLAPELVSGNGHGSGVDWWA
FGIFLYELLYGTTPFKGESKEQTLRNIVSTTKTASFHMDGDLDEARDLIEKLLVKDPRKRLGCARGAQDIKRHPFFDGIK
WPLIRHYKPPEEVRGLVIKKSTRPHASHVIAVSPRRRKSFLWRALSYLLRGKSSSGGSKNQSNSNYYHYVGKSYASRKRV
*

DNA
ATGGAACAAGAAGATTTCTATTTCCCTGACACCGATCTTGATCTCAGCTTCACATCCACCACTACCGACCGTACATTCGC
CTCCTCGAGCGCTCGCACAAGTCTAACATTAAGCTTCAACGACAGACTCTCTACTTCCTCTGCAGTCACAACCTCATCCA
CCTCCTCCTCCTCCGTCAACCACCGTCGTCATGATCCTCACTGGTCAGCAATCAAATCAGCAAAACTTCTCTCCTCCGAC
GGAAACATCCACCTCCGCCACCTGAAACTTATACGCCACCTCGGCACCGGAAACCTAGGCCGAGTGTTCCTCTGTAACCT
CCGTGACTCTTCCGCAAGATTCGCTTTAAAGGTCATCGACCGTAACTGTCTCACGACGGAGAAGAAGCTCTCTCAGGTCG
AGACGGAGGCAGAGATCCTCTCCTTGCTGGACCACCCTTTTCTTCCTACGCTCTATGCTCGTATCGACGAGTCTCACTAC
ACGTGTCTCCTCATTGATTATGCTCCCAATGGAGACTTACATTCCTTGTTACGCAAGCAACCTGGTAACCGTTTACCGAT
TCAGCCGGTTAGATTCTTTGCCGCCGAAGTTCTCGTTGCATTAGAGTACCTTCACGCAATGGGAATCGTATACCGCGATC
TTAAACCTGAAAACGTTTTGCTTCGTGAAGACGGACACGTCATGTTGTCGGATTTTGATCTTTGTTTCAAATCCGACGTT
GTCCCTACTTTTAAATCTCGTCGCTACCGGAGATCTTCTTCATCTCCGTCGCTTCGTCGTAGAAGAAGCGGTTGCTTCTC
CGTTGCTGCGGAGAAAAAGTACGAGAGAGAGGAGATTGTTTCAGAGTTTGCGGCAGAGCCTGTAACGGCGTTTTCAAGAT
CTTGTGTCGGAACACATGAGTATCTTGCGCCGGAGCTAGTTTCCGGCAACGGACACGGAAGCGGAGTAGACTGGTGGGCG
TTCGGAATATTCCTTTACGAGTTATTGTACGGTACGACGCCGTTTAAGGGAGAGAGTAAAGAGCAAACACTGCGGAATAT
AGTATCGACCACTAAGACCGCGAGTTTCCATATGGACGGTGATTTAGATGAAGCTAGGGACTTGATTGAGAAGCTTTTGG
TTAAGGACCCAAGGAAAAGGCTAGGATGCGCCAGGGGTGCGCAAGATATCAAACGTCATCCGTTTTTTGATGGAATCAAG
TGGCCGTTGATTAGGCATTATAAGCCACCGGAAGAAGTTAGAGGTCTTGTGATTAAGAAGTCAACGAGACCACATGCTAG
TCACGTGATTGCCGTTTCACCGCGACGGAGAAAATCGTTTTTGTGGAGGGCGTTGTCATATTTACTGCGCGGTAAAAGCT
CTAGTGGTGGGAGTAAAAATCAGAGCAATAGTAATTATTATCACTATGTGGGCAAAAGCTACGCGAGTCGCAAACGCGTT
TAA