Details for Arabidopsis Locus AT3G14330

Position : Chr3 ( 5`- 4779688 .. 4782452 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14330

Protein [Map View]
MMIGKLWRSVGTVGKFDGRYDGVRTMVGKASNRAGVHVTDTVLFEETSFEFSPSLTPELNEFPMPSLDVITPQAYLTPLG
SQSINHAKFLQIPWRQFVFTKPLGLSKSTKLDEAVTLIENSSSSPSNLSTPEAYTDLLHACISAKSLHHGIKICSLILNN
PSLRHNPKLLSKLITLFSVCRRLDLARKIFDDVTDSSLLTEKVWAAMAIGYSRNGSPRDALIVYVDMLCSFIEPGNFSIS
VALKACVDLKDLRVGRGIHAQIVKRKEKVDQVVYNVLLKLYMESGLFDDARKVFDGMSERNVVTWNSLISVLSKKVRVHE
MFNLFRKMQEEMIGFSWATLTTILPACSRVAALLTGKEIHAQILKSKEKPDVPLLNSLMDMYGKCGEVEYSRRVFDVMLT
KDLASWNIMLNCYAINGNIEEVINLFEWMIESGVAPDGITFVALLSGCSDTGLTEYGLSLFERMKTEFRVSPALEHYACL
VDILGRAGKIKEAVKVIETMPFKPSASIWGSLLNSCRLHGNVSVGEIAAKELFVLEPHNPGNYVMVSNIYADAKMWDNVD
KIREMMKQRGVKKEAGCSWVQVKDKIQIFVAGGGYEFRNSDEYKKVWTELQEAIEKSGYSPNTSVVLHDVDEETKANWVC
GHSERLATTYSLIHTGEGVPIRITKNLRVCADCHSWMKIVSQVTRRVIVLRDTKRFHHFVDGICSCKDYW*

DNA
ATGATGATCGGGAAGTTGTGGAGATCTGTGGGAACCGTCGGAAAGTTTGATGGTCGTTACGACGGCGTGAGGACGATGGT
TGGAAAAGCCTCGAACCGAGCTGGTGTTCATGTCACAGATACTGTACTTTTCGAAGAGACGAGTTTCGAATTTTCGCCTT
CTCTCACTCCTGAGCTGAATGAATTTCCAATGCCTTCTTTAGATGTTATCACTCCACAAGCTTATCTTACTCCACTGGGG
TCTCAGAGTATCAACCATGCTAAATTTTTACAAATCCCATGGAGACAATTTGTCTTCACAAAGCCTTTAGGTCTCTCTAA
ATCAACCAAACTCGACGAAGCCGTGACATTGATAGAGAATTCATCATCCTCGCCGTCCAATCTCTCCACTCCCGAAGCTT
ACACAGACCTTCTTCATGCTTGTATCTCCGCTAAATCACTCCACCATGGTATAAAAATATGTTCTTTGATTCTCAACAAT
CCTAGTCTCCGTCACAACCCCAAATTGCTAAGCAAGCTCATTACCCTATTCTCGGTTTGTCGCCGATTGGATCTTGCTCG
GAAAATCTTTGACGATGTAACTGATTCGAGTCTACTTACTGAGAAAGTCTGGGCAGCTATGGCGATTGGGTATTCTAGAA
ACGGGTCACCAAGAGACGCTTTGATCGTCTATGTGGATATGTTGTGTAGCTTCATTGAGCCTGGGAATTTTTCGATATCC
GTGGCGTTGAAAGCGTGCGTGGATTTGAAAGATCTTCGGGTTGGTAGAGGAATCCATGCCCAGATTGTGAAACGAAAGGA
GAAGGTTGACCAAGTAGTGTATAATGTGCTCTTGAAGCTTTATATGGAAAGTGGCTTATTTGATGATGCACGTAAGGTGT
TCGATGGAATGTCTGAGAGAAATGTTGTTACTTGGAATTCTTTAATTTCGGTACTCAGTAAGAAAGTTCGGGTTCATGAG
ATGTTTAATCTGTTCAGGAAGATGCAGGAAGAGATGATCGGGTTTAGTTGGGCGACGTTGACGACAATATTACCCGCTTG
TTCACGTGTCGCTGCTCTTCTCACCGGGAAAGAGATTCATGCACAGATTCTGAAATCGAAAGAGAAACCTGATGTTCCAT
TGCTTAATTCATTGATGGATATGTATGGGAAATGTGGAGAGGTTGAGTATTCTCGGAGAGTCTTTGATGTGATGTTAACT
AAGGATTTGGCTTCATGGAACATAATGCTAAACTGTTATGCAATCAACGGAAATATTGAAGAAGTGATAAATCTGTTTGA
ATGGATGATAGAGTCAGGCGTTGCACCAGATGGGATTACCTTTGTTGCTTTGTTATCTGGGTGTAGCGATACAGGGCTTA
CGGAATATGGTCTAAGTTTGTTTGAACGCATGAAAACGGAGTTCAGAGTTTCACCGGCTTTGGAGCATTATGCTTGTTTG
GTTGACATCTTGGGGCGAGCTGGTAAGATCAAAGAAGCAGTGAAGGTGATAGAAACAATGCCATTTAAGCCAAGTGCGTC
CATTTGGGGATCACTGCTCAACTCTTGCAGGCTTCATGGGAATGTTTCAGTGGGAGAGATTGCAGCAAAAGAGTTGTTTG
TTCTTGAACCTCATAATCCAGGGAACTACGTTATGGTTTCTAACATATATGCTGATGCAAAGATGTGGGACAATGTGGAT
AAGATTCGAGAGATGATGAAACAAAGAGGGGTCAAAAAGGAAGCTGGTTGCAGTTGGGTACAGGTTAAAGACAAGATTCA
AATCTTTGTTGCAGGAGGTGGTTATGAGTTTCGTAATTCTGATGAGTATAAGAAAGTATGGACAGAACTACAAGAAGCAA
TTGAAAAATCCGGTTATTCGCCTAATACGAGTGTGGTGCTTCATGATGTTGATGAAGAAACCAAAGCAAATTGGGTTTGT
GGACACAGCGAGAGACTCGCGACAACCTACTCCCTAATCCACACAGGTGAAGGGGTTCCAATTAGGATTACCAAGAATCT
CAGAGTATGTGCAGACTGTCATTCATGGATGAAGATTGTGTCACAAGTAACTAGGAGAGTCATAGTCCTCAGAGACACAA
AACGATTCCACCATTTCGTCGACGGAATCTGCTCATGTAAAGACTACTGGTGA