Details for Arabidopsis Locus AT3G14320

Position : Chr3 ( 5`- 4777731 .. 4778345 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14320

Protein [Map View]
MKESDAVILIHLGINIVFAFFFFGISAVVVSCIIKCYNTHDDDHDHDNNNDGHVSITIKERVGIKPYVLRSIPIVDFNTK
DFKYVLECVVCLSELADGDKARVLPSCDHWFHVECIDSWLQSNSTCPICRKRVCLKQSRTRPELGGRDKSFNQNHDQTSE
HHEFSTDPPTNTDTAIIEDGGCGEANEGQPELTAVVIDIPAKEI*

DNA
ATGAAAGAATCCGATGCTGTCATTCTAATACATCTCGGAATAAATATTGTCTTCGCTTTCTTTTTCTTTGGGATTTCGGC
CGTGGTAGTGAGTTGCATCATTAAATGTTATAATACTCATGATGATGATCATGATCATGACAACAACAACGATGGTCATG
TCAGCATCACCATCAAGGAACGTGTCGGTATAAAGCCTTACGTTCTACGATCGATCCCTATCGTAGACTTCAATACCAAA
GACTTCAAATACGTCCTCGAATGCGTCGTTTGTCTCTCGGAGCTAGCCGATGGAGACAAAGCTAGGGTTTTGCCGAGCTG
TGATCACTGGTTTCACGTTGAATGTATAGACTCCTGGCTGCAATCAAACTCCACTTGTCCTATATGTAGAAAGAGAGTTT
GTTTGAAGCAGTCAAGAACGAGACCAGAACTTGGCGGCCGCGACAAGAGTTTTAACCAAAACCACGACCAAACATCCGAA
CATCATGAGTTTTCGACAGATCCTCCGACGAACACAGACACGGCGATTATTGAAGATGGTGGCTGCGGCGAAGCAAACGA
AGGTCAACCAGAATTAACGGCGGTGGTGATAGACATTCCGGCGAAAGAGATATAA