Details for Arabidopsis Locus AT3G14300

Position : Chr3 ( 5`- 4766905 .. 4769898 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14300

Protein [Map View]
MDTVKSINKGYGKVDETQDLALKRKTRKRLYQIGISVAVLVAIIISSTVTIAIHSRKGNSPHPTPSSVPELTPAASLKTV
CSVTNYPVSCFSSISKLPLSNTTDPEVIFRLSLQVVIDELNSIVELPKKLAEETDDEGLKSALSVCEHLLDLAIDRVNET
VSAMEVVDGKKILNAATIDDLLTWLSAAVTYHGTCLDALDEISHTNSAIPLKLKSGMVNSTEFTSNSLAIVAKILSTISD
FGIPIHGRRLLNSSPHATPISVPKLTPAASLRNVCSVTRYPASCVSSISKLPSSNTTDPEALFRLSLQVVINELNSIAGL
PKKLAEETDDERLKSSLSVCGDVFNDAIDIVNDTISTMEEVGDGKKILKSSTIDEIQTWLSAAVTDHDTCLDALDELSQN
KTEYANSPISLKLKSAMVNSRKFTSNSLAIIAKFPIHERHGVQSPRLRKSPHPTPSSVLRTVCNVTNYPASCISSISKLP
LSKTTTDPKVLFRLSLQVTFDELNSIVGLPKKLAEETNDEGLKSALSVCADVFDLAVDSVNDTISSLDEVISGGKKNLNS
STIGDLITWLSSAVTDIGTCGDTLDEDNYNSPIPQKLKSAMVNSTEFTSNSLAIVAQVLKKPSKSRIPVQGRRLLNSNSF
PNWVRPGVRRLLQAKNLTPHVTVAADGSGDVRTVNEAVWRVPKKGKTMFVIYVKAGTYVENVLMKKDKWNVFIYGDGRDK
TIISGSTNMVDGVRTFNTSTFATEGKGFMMKDMGIINTAGPEKHQAVAFRSDSDRSVYYRCSFDGYQDTLYTHSNRQYYR
NCDVTGTVDFIFGAGTVVFQGCSIRPRQPLPNQFNTITAEGTQEANQNTGISIHQCTISPNGNVTATTYLGRPWKLFSKT
VIMQSVIGSFVNPAGWIAWNSTYDPPPRTIFYREYKNSGPGSDLSKRVKWAGYKPISSDDEAARFTVKYFLRGDDNWIPK
AVMGMPPL*

DNA
ATGGATACTGTCAAGTCAATCAACAAAGGCTATGGCAAAGTTGACGAAACTCAAGATTTGGCGTTGAAGAGAAAGACGAG
AAAGCGTTTGTATCAAATAGGCATTTCCGTGGCAGTTCTGGTGGCGATTATCATCAGCTCCACCGTCACCATCGCAATTC
ACAGCCGGAAAGGCAATTCACCACATCCAACACCGAGTTCAGTCCCCGAGTTGACTCCCGCCGCTTCACTCAAAACTGTG
TGTAGCGTAACTAATTACCCTGTTTCTTGCTTCTCAAGCATCTCGAAGCTTCCATTGTCCAACACGACGGATCCGGAGGT
TATATTCAGGCTTTCTTTACAAGTTGTCATTGACGAACTCAACTCAATCGTTGAGTTACCGAAGAAGCTCGCTGAAGAGA
CGGACGATGAGGGACTCAAATCGGCGCTTAGTGTTTGCGAACATCTGTTAGACCTCGCTATTGATCGTGTTAACGAAACT
GTTTCCGCCATGGAAGTTGTTGACGGGAAGAAGATTTTGAATGCTGCGACCATTGACGATCTCCTTACTTGGCTCAGCGC
CGCTGTGACATACCACGGAACGTGTCTCGACGCGCTTGATGAAATCAGCCACACGAATTCAGCAATCCCACTGAAGCTTA
AATCTGGCATGGTTAACTCGACCGAGTTCACAAGTAACAGCTTAGCGATCGTTGCGAAGATTCTCTCTACAATAAGCGAT
TTTGGGATCCCGATTCACGGGAGACGGCTTCTAAACTCATCACCACATGCAACACCAATTTCAGTCCCCAAGTTGACTCC
CGCCGCTTCACTCAGAAATGTATGCAGCGTAACTCGTTACCCTGCTTCTTGTGTCTCAAGCATCTCAAAGCTTCCATCGT
CTAACACGACGGATCCGGAGGCTTTATTCAGGCTTTCGTTACAAGTTGTCATCAACGAACTCAATTCGATCGCCGGTTTA
CCGAAGAAGCTCGCCGAAGAGACGGACGATGAGAGACTCAAATCGTCTCTTAGTGTTTGTGGAGATGTGTTCAACGACGC
GATTGATATAGTCAACGATACTATTTCCACCATGGAAGAAGTTGGTGACGGGAAGAAGATTTTGAAGTCGTCGACCATCG
ACGAGATTCAAACTTGGCTTAGCGCCGCCGTAACAGATCACGACACGTGTCTCGACGCACTTGATGAACTCAGCCAGAAC
AAAACAGAGTACGCGAATTCACCAATCTCACTAAAGCTTAAATCCGCCATGGTCAATTCCAGAAAGTTCACAAGCAACAG
CTTAGCGATCATCGCGAAGTTTCCAATACACGAAAGACACGGAGTTCAGTCCCCGCGGCTTCGAAAGTCACCTCATCCAA
CACCGAGTTCAGTCCTCAGAACTGTGTGTAATGTAACTAATTACCCTGCTTCTTGTATCTCAAGCATCTCGAAGCTTCCA
TTATCCAAAACGACGACAGATCCGAAGGTTTTATTCAGGCTTTCGTTACAAGTTACATTCGACGAACTCAATTCCATCGT
TGGTTTACCGAAGAAACTCGCGGAAGAGACTAATGATGAGGGACTCAAATCGGCGCTTAGTGTTTGCGCAGATGTGTTCG
ACCTCGCGGTTGATTCAGTTAACGATACTATTTCCTCCTTGGATGAAGTAATTAGTGGCGGGAAGAAGAATTTGAATTCG
TCAACGATCGGCGATCTCATAACGTGGCTTAGCTCCGCCGTAACAGATATCGGGACGTGTGGCGACACGCTTGATGAAGA
TAACTACAACTCACCAATCCCACAGAAGCTTAAATCCGCCATGGTTAATTCCACAGAGTTCACAAGCAACAGCTTAGCCA
TCGTCGCGCAGGTTCTCAAAAAACCAAGCAAGTCTAGGATCCCGGTTCAGGGGAGACGGCTACTTAACTCGAATTCGTTT
CCAAATTGGGTTAGACCAGGAGTGAGGCGGTTACTTCAAGCGAAGAACTTAACGCCTCATGTTACGGTGGCGGCGGATGG
CTCCGGCGATGTGAGGACGGTGAATGAAGCGGTTTGGAGAGTTCCGAAGAAGGGGAAAACGATGTTTGTTATATACGTGA
AAGCAGGTACGTATGTGGAGAATGTCCTTATGAAAAAGGATAAATGGAATGTGTTTATCTACGGCGACGGCAGGGATAAG
ACCATTATTTCCGGTAGCACTAACATGGTCGACGGGGTTCGTACTTTCAATACCTCCACGTTTGCAACTGAAGGCAAAGG
ATTTATGATGAAGGACATGGGAATCATAAACACCGCCGGGCCAGAGAAGCATCAAGCGGTAGCATTCCGATCAGATTCCG
ATCGGTCAGTCTACTATCGATGTTCATTCGACGGCTACCAAGATACTCTTTATACTCACTCAAATCGACAATACTATCGT
AACTGTGACGTCACCGGAACAGTTGATTTCATCTTCGGAGCTGGCACAGTCGTCTTCCAAGGCTGCAGCATCCGTCCGCG
TCAGCCGCTTCCGAATCAGTTCAACACAATCACCGCTGAAGGTACACAAGAGGCCAATCAGAACACGGGAATATCGATCC
ACCAATGCACAATCTCTCCCAACGGAAATGTAACTGCTACGACGTATCTTGGCCGTCCGTGGAAATTGTTTTCGAAGACG
GTTATTATGCAATCGGTGATTGGGTCGTTCGTGAATCCCGCTGGGTGGATTGCGTGGAATTCGACTTATGACCCGCCTCC
ACGTACTATATTCTATAGAGAGTACAAGAATTCAGGTCCTGGGTCGGATCTATCCAAGAGAGTTAAATGGGCTGGGTATA
AGCCCATTTCGTCTGATGATGAGGCTGCAAGGTTTACGGTTAAGTATTTTCTCCGAGGGGATGATAATTGGATTCCAAAG
GCGGTTATGGGAATGCCCCCTCTGTAA