Details for Arabidopsis Locus AT3G14270

Position : Chr3 ( 5`- 4753925 .. 4761456 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14270

Protein [Map View]
MGTRDSNNRTFSEIVGLIKSWLPWRSEPATVSRDFWMPDQSCRVCYECDCQFTLINRRHHCRHCGRVFCGKCTANSIPFA
PSDLRTPREDWERIRVCNYCFRQWEQGDGGPHVSNITELSTSPSETSLLSSKTSTTANSSSFALGSMPGLIGLNQRVHHG
SDVSLHGVSSMETSVTKQGKETSRRSSFIATDVEDPSRFALNSIRSDDEYDEYGAYQTDIETSHSPRANEYYGPMEYNGM
GIDDVPCKHLGGETADQKSLSGSPLIHQCLESLIREGSEQFQKKSEHDGRDECEASSPADISDDQVVEPVDFENNGLLWV
PPEPENEEDERESALFDEEDNEGDASGEWGYLRPSTSFGSGEYRGEDRTTEEHKKAMKNVVDGHFRALLAQLLQVENISV
SDEEGKESWLEIITSLSWEAANLLKPDMSKSGGMDPGGYVKVKCLASGFRHDSMVVKGVVCKKNVVNRRMSTKIEKARLL
ILGGGLEYQRVSNQLSSFDTLLQQEKDHLKMAVAKIHAERPNILLVEKSVSRFAQEYLLAKDISLVLNIKRPLLDRIARC
TGAQIIPSVDHLSSQKLGYCENFRVDRYPEEHGSTGQVGKKVVKTLMYFEHCPKPLGFTILLRGANEDELKKVKHVVQYG
VFAAYHLALETSFLADEGASPELPLNSPITVALPDKSTSIERSISTVPGFTVSTYEKSPTMLSCAEPQRANSVPVSELLS
TTTNLSIQKDIPPIPYGSGWQAREINPSFVFSRHNISLNLPDRVIESRNSDLSGRSVPVDTPADKSNPIVVADETTNNSL
HLSGQGFVRKSSQIGTSIMVENQDNGSELTIAQQQNNEKPKETQSQKEEFPPSPSDHQSILVSLSSRSVWKGTVCERSHL
FRIKYYGSFDKPLGRFLRDHLFDQSYRCRSCEMPSEAHVHCYTHRQGSLTISVKKLQDYLLPGEKEGKIWMWHRCLRCPR
LNGFPPATLRVVMSDAAWGLSFGKFLELSFSNHAAASRVACCGHSLHRDCLRFYGFGNMVACFRYATIDVHSVYLPPSIL
SFNYENQDWIQRETDEVIERAELLFSEVLNAISQIAEKGFRRRIGELEEVLQKEKAEFEENMQKILHREVNEGQPLVDIL
ELYRIHRQLLFQSYMWDHRLINASTLHKLENSDDTKREENEKPPLAKSQTLPEMNAGTNSLLTGSEVNLNPDGDSTGDTG
SLNNVQKEADTNSDLYQEKDDGGEVSPSKTLPDTSYPLENKVDVRRTQSDGQIVMKNLSATLDAAWIGERQTSVEIPTNN
KVSLPPSTMSNSSTFPPISEGLMPIDLPEQQNEFKVAYPVSPALPSKNYENSEDSVSWLSVPFLNFYRSINKNFLLSSQK
LDTFGEHSPIYISSFREAELQGGPRLLLPVGLNDIVVPVYDDEPTSMIAYALMSPEYQRQTSAEGESLVSYPSELNIPRP
VDDTIFDPSRSNGSVDESILSISSSRSTSLLDPLSYTKALHARVSYGEDGTLGKVKYTVTCYYAKRFEALRGICLPSELE
YIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESISTKSPTCLAKILGIYQVATKQL
KSGKETKMDVLIMENLLFGRTVKRLYDLKGSSRARYNPDSSGSNKVLLDQNLIEAMPTSPIFVGNKAKRLLERAVWNDTA
FLALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESWVKFTGILGGPKNEAPTVISPKQYKRRFRKAMTTYFLM
VPDQWSPPNVVANNSKSDQPEETSQAGTQAE*

DNA
ATGGGTACAAGAGATAGTAATAATAGGACATTCTCTGAGATTGTGGGTCTGATTAAATCCTGGCTCCCCTGGCGATCCGA
GCCAGCTACTGTGTCCAGGGATTTTTGGATGCCTGATCAGAGCTGTCGTGTATGTTACGAGTGTGATTGTCAGTTTACCC
TCATCAATCGTAGGCACCATTGTCGTCATTGTGGGAGAGTTTTCTGTGGCAAGTGTACTGCCAACTCTATTCCTTTTGCT
CCCAGCGACTTGAGAACTCCTCGTGAAGACTGGGAGAGGATACGTGTTTGCAATTATTGTTTCAGGCAGTGGGAGCAAGG
TGATGGTGGCCCACACGTCTCAAATATCACGGAACTTAGTACTTCACCTTCAGAGACAAGTCTTCTTAGCTCTAAGACCA
GTACAACAGCCAATAGTAGTAGCTTCGCTCTTGGCTCCATGCCGGGACTGATTGGTCTTAATCAAAGGGTTCATCATGGT
TCTGATGTCAGCTTGCACGGAGTATCTTCAATGGAGACAAGCGTAACCAAGCAAGGCAAAGAAACTTCAAGGAGGAGCAG
CTTCATTGCCACAGACGTGGAAGATCCATCTCGCTTTGCTTTAAATAGCATCAGGAGTGATGATGAGTACGACGAGTATG
GTGCATACCAGACTGATATTGAGACGAGTCATTCTCCTCGAGCTAATGAATATTATGGTCCAATGGAATACAATGGAATG
GGCATTGATGATGTCCCCTGTAAGCATCTTGGTGGAGAAACCGCGGACCAGAAAAGTTTAAGCGGCTCTCCACTCATTCA
TCAGTGCCTTGAATCTCTGATTCGGGAAGGATCAGAGCAGTTCCAGAAGAAAAGTGAGCATGATGGTCGTGACGAATGTG
AAGCTTCTTCTCCAGCAGATATTTCAGATGATCAAGTGGTAGAACCTGTGGATTTCGAGAACAATGGACTTTTGTGGGTT
CCACCTGAGCCAGAAAATGAAGAAGACGAGAGAGAAAGTGCTTTGTTTGATGAGGAAGATAACGAGGGAGATGCCTCAGG
TGAGTGGGGATACTTACGACCTTCCACTAGCTTTGGAAGTGGAGAGTACCGTGGCGAGGATCGAACAACTGAAGAGCACA
AGAAGGCTATGAAGAATGTGGTTGATGGGCACTTTAGGGCTTTGCTTGCACAACTGTTGCAAGTTGAGAACATCTCTGTG
AGCGATGAAGAGGGCAAAGAGAGCTGGTTAGAGATTATCACCTCTCTTTCTTGGGAGGCTGCTAACTTATTGAAGCCTGA
TATGAGCAAAAGTGGAGGAATGGATCCTGGTGGCTATGTCAAAGTAAAGTGCCTAGCTTCTGGATTCCGACATGATAGCA
TGGTGGTAAAGGGAGTTGTTTGCAAGAAAAATGTGGTTAATAGGAGAATGAGTACGAAGATTGAGAAAGCTCGACTATTG
ATTCTAGGCGGTGGACTTGAGTATCAAAGGGTCTCAAACCAGTTATCAAGTTTTGATACTTTGTTGCAACAGGAAAAGGA
TCATCTAAAGATGGCTGTTGCTAAGATTCACGCTGAACGTCCAAATATTCTACTAGTCGAAAAATCAGTTTCTCGATTTG
CGCAAGAGTATCTTCTAGCCAAAGACATATCTCTTGTTCTAAACATCAAGAGGCCACTTTTAGACCGCATTGCTCGCTGC
ACTGGTGCTCAAATAATTCCTTCAGTAGACCACCTCTCCTCTCAAAAGCTGGGTTACTGTGAGAATTTTCGGGTGGATAG
GTATCCTGAAGAACATGGTTCAACTGGTCAAGTTGGAAAGAAAGTGGTGAAGACGTTGATGTATTTTGAGCATTGTCCAA
AGCCATTAGGCTTTACTATTTTGCTGAGGGGTGCAAATGAAGATGAGTTGAAAAAAGTGAAGCATGTGGTCCAGTATGGA
GTTTTTGCAGCTTATCATTTGGCACTCGAAACATCGTTTCTTGCTGATGAGGGAGCCTCACCAGAACTTCCTTTGAATTC
CCCGATTACGGTGGCACTTCCAGATAAATCTACGAGCATTGAACGTTCAATATCTACTGTGCCAGGTTTCACGGTCTCAA
CATATGAAAAATCTCCGACAATGCTATCTTGTGCTGAACCACAACGAGCAAACAGTGTTCCAGTATCAGAGTTGCTCTCT
ACCACTACCAATCTATCCATCCAGAAGGATATCCCTCCTATACCCTATGGTTCAGGCTGGCAGGCTAGAGAAATAAACCC
GAGTTTCGTCTTTTCACGCCATAATATTTCATTGAATTTGCCTGACCGTGTGATAGAGAGCAGAAACTCAGATTTGTCTG
GAAGATCTGTACCGGTGGACACACCAGCTGACAAAAGCAATCCAATTGTTGTGGCAGATGAGACAACGAACAATTCCTTA
CATTTATCAGGGCAAGGCTTTGTGCGAAAGAGTTCTCAAATTGGTACGAGCATTATGGTCGAAAACCAAGACAATGGTTC
AGAGCTTACAATCGCCCAACAACAAAACAATGAGAAACCAAAGGAAACACAATCCCAAAAAGAAGAATTTCCTCCGTCAC
CCTCTGACCACCAGAGCATTTTGGTTTCTCTATCATCCCGATCAGTGTGGAAAGGAACTGTGTGTGAAAGGTCTCATCTC
TTTCGGATAAAATACTATGGTAGTTTTGATAAACCCTTGGGACGGTTCTTGAGAGATCATTTGTTCGATCAGAGTTACAG
GTGCCGGTCATGTGAGATGCCATCAGAAGCTCATGTTCACTGTTACACTCATCGACAAGGCAGCCTTACGATATCTGTCA
AGAAACTTCAAGATTATCTCTTACCTGGTGAAAAGGAGGGGAAGATCTGGATGTGGCATAGATGCCTGAGATGCCCGCGA
CTTAACGGCTTCCCTCCAGCGACTCTACGAGTGGTTATGTCTGATGCTGCATGGGGATTATCGTTTGGGAAGTTTCTGGA
GCTCAGTTTCTCAAATCACGCAGCTGCTAGTAGAGTAGCTTGTTGTGGCCATTCTCTGCATAGAGATTGTCTTCGCTTCT
ATGGATTTGGGAACATGGTTGCTTGCTTCCGGTACGCTACTATAGATGTTCATTCGGTCTACCTTCCACCATCAATTCTT
AGTTTCAACTACGAGAATCAGGATTGGATACAGAGAGAGACAGACGAGGTGATAGAGAGAGCAGAGCTTCTGTTTTCTGA
AGTATTAAATGCTATTAGTCAAATTGCAGAGAAAGGTTTCAGGCGACGAATTGGTGAACTCGAAGAAGTGCTGCAAAAAG
AGAAAGCGGAATTTGAGGAGAATATGCAAAAGATTTTGCACAGGGAGGTGAACGAAGGCCAACCTCTCGTGGACATTCTT
GAGCTATATCGGATTCACAGACAACTTCTTTTTCAGTCATACATGTGGGATCACCGCTTAATTAATGCATCTACTTTACA
TAAGCTTGAGAATAGTGATGACACAAAGAGAGAAGAGAACGAGAAACCTCCCTTGGCTAAGAGCCAGACGCTCCCGGAGA
TGAATGCTGGGACCAACTCTCTTCTTACTGGCTCTGAGGTTAATCTGAATCCTGATGGTGATTCTACTGGTGACACTGGC
TCCTTAAATAATGTTCAGAAAGAAGCGGATACGAATTCAGATTTGTATCAGGAAAAGGATGATGGGGGAGAAGTTTCTCC
CAGCAAGACCTTACCAGATACATCTTATCCTCTGGAAAATAAAGTCGATGTTCGTAGAACACAGTCTGATGGCCAGATAG
TTATGAAAAATCTATCAGCCACTCTTGATGCAGCATGGATAGGTGAACGTCAAACATCTGTGGAGATTCCAACCAACAAT
AAGGTCTCGCTTCCTCCTTCCACCATGTCAAACTCTTCAACTTTTCCTCCAATCTCAGAGGGGCTAATGCCTATAGATCT
CCCAGAACAGCAAAATGAGTTCAAGGTGGCCTATCCTGTTTCCCCAGCATTACCGAGTAAGAATTATGAGAATTCAGAAG
ACTCTGTCAGCTGGCTAAGTGTGCCATTCCTCAACTTCTACCGTTCCATTAACAAGAATTTCCTGCTTAGCTCTCAGAAG
CTTGATACATTTGGCGAGCATAGCCCTATCTATATTTCATCTTTTAGAGAGGCAGAGCTTCAAGGTGGACCAAGGCTACT
TCTGCCCGTAGGCTTAAATGATATTGTTGTTCCGGTTTATGATGATGAACCTACTAGTATGATCGCATATGCCTTAATGT
CACCAGAATATCAACGCCAAACTTCTGCTGAAGGGGAATCTCTAGTTTCATATCCTTCTGAACTCAATATCCCTCGCCCA
GTTGATGATACCATTTTTGACCCTAGCAGAAGCAATGGTTCAGTCGACGAGAGCATACTTTCAATATCCTCATCTCGCAG
TACCTCACTTCTGGACCCACTATCATATACAAAAGCTTTACATGCTCGAGTCTCATATGGAGAGGACGGTACGCTTGGAA
AAGTGAAGTACACTGTTACTTGTTACTATGCAAAGCGGTTTGAGGCGCTACGGGGTATATGTCTCCCTTCGGAACTTGAG
TATATACGGTCTCTTAGCCGGTGTAAAAAATGGGGAGCTCAAGGTGGCAAGAGCAATGTCTTCTTTGCTAAAACCCTGGA
CGATCGATTTATCATCAAGCAAGTCACCAAGACAGAGTTGGAATCATTCATCAAATTTGCACCTGCTTACTTTAAATACT
TGTCTGAGTCTATCAGCACGAAAAGCCCAACCTGCCTGGCAAAAATCTTGGGAATCTATCAGGTCGCAACAAAGCAACTT
AAGAGCGGGAAAGAAACAAAGATGGATGTTCTGATTATGGAGAATCTTCTGTTTGGAAGAACTGTGAAACGGCTTTATGA
CCTTAAAGGATCTTCGCGGGCGCGCTACAATCCTGACTCTAGTGGGAGCAACAAAGTCTTGTTGGATCAAAACTTGATTG
AAGCAATGCCAACTTCTCCCATTTTCGTCGGTAACAAAGCAAAACGATTGTTGGAAAGAGCTGTCTGGAACGATACTGCT
TTTCTTGCATTGGGTGATGTGATGGATTATTCATTGCTAGTAGGCGTGGATGAAGAAAAGAACGAGCTAGTTCTCGGGAT
TATCGACTTCTTGAGGCAGTACACATGGGACAAGCATCTAGAGTCTTGGGTGAAATTTACAGGAATCTTAGGAGGACCAA
AGAATGAAGCACCAACAGTAATCTCTCCAAAGCAATATAAGAGAAGATTCAGAAAAGCAATGACAACTTACTTCCTCATG
GTCCCTGATCAATGGTCTCCGCCTAATGTTGTTGCAAATAACTCCAAGTCTGATCAACCTGAAGAAACCTCTCAAGCCGG
TACACAAGCAGAGTGA