Details for Arabidopsis Locus AT3G14260

Position : Chr3 ( 5`- 4747769 .. 4748819 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14260

Protein [Map View]
MQIYRRPFETKTWQYRICPAETMVKIHPDLTTSGAGEETSSPYLTTEQESFTIWMKSLVFNTNGCTVFDSKGNIIYRVDN
YNSKSCREVYLMDLSGHVLFTLRRQKFGLFKTWEGYRSSSATVESTTKLEYFRVKNNVFQVPNKDSSSSYRVNAGSCRND
EQYCYKMVTRGSSLAIEDNCGKLLAEVKRKQSINGLKLGDDVLTMMVESQVDHSFIIGLVLAHSLINCIL*

DNA
ATGCAAATATACCGACGACCTTTTGAGACAAAAACTTGGCAATATCGAATCTGTCCAGCAGAGACTATGGTGAAGATTCA
TCCCGATCTAACAACCTCCGGCGCCGGAGAAGAAACAAGTTCACCGTACTTGACGACGGAGCAAGAGAGTTTCACTATAT
GGATGAAGTCGTTGGTGTTCAACACAAATGGCTGCACCGTCTTCGATTCCAAAGGAAACATAATTTATCGTGTCGACAAT
TATAATTCTAAGAGCTGTCGTGAAGTTTATCTCATGGATTTGTCCGGTCATGTCTTGTTTACCTTACGTAGACAGAAATT
TGGATTATTCAAGACATGGGAAGGATATAGATCATCATCAGCAACAGTTGAATCAACAACAAAACTAGAATATTTTCGAG
TGAAAAATAATGTTTTTCAAGTTCCAAATAAAGATTCATCATCTTCGTATAGAGTCAACGCGGGATCATGTAGAAACGAT
GAACAATATTGTTATAAGATGGTAACTCGCGGATCAAGTCTAGCGATTGAGGATAATTGTGGAAAACTATTGGCAGAAGT
GAAGAGAAAACAATCGATAAACGGTTTGAAGTTGGGAGATGATGTTTTGACGATGATGGTGGAGTCACAAGTTGATCACT
CTTTCATCATTGGACTTGTTTTAGCTCATAGTCTTATCAATTGTATACTGTAA