Details for Arabidopsis Locus AT3G14250

Position : Chr3 ( 5`- 4745926 .. 4746958 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14250

Protein [Map View]
MGSSSSSSSTKVDTDMLVDETYLSALFDYDEIFPIADESYATEIHLQEAMFSSFGASTVGVNHHPQVHRNLVTLVKQEPE
IKAENEPMEPSRRLCMICMDEKPSSDIFRGTTNCTHAYCTDCTVRYVATKIKENASRIKCPDVECTRLIEPYTCRDLIPK
DVFDRWEKILCESLISSWDKFYCPFKDCSAMMVNNENGDANVTQTECRSCHRLFCVQCKVTWHAGIGCDEFQRFGNTKKK
SSDEDDALLIQMAKNKQWRRCPSCKFYVDKVEGCQHIKCRCGYQFCYGCGSVWSSSHACQIRI*

DNA
ATGGGTTCATCATCATCGTCGTCAAGCACAAAGGTGGACACCGATATGTTGGTAGACGAAACCTACCTCTCTGCTTTATT
CGATTACGATGAAATTTTCCCAATCGCCGACGAAAGCTATGCTACGGAGATCCATCTCCAAGAAGCTATGTTTTCTTCTT
TTGGCGCTTCTACTGTTGGTGTTAATCATCATCCTCAAGTCCATAGGAATCTAGTCACGCTGGTTAAGCAGGAACCGGAG
ATTAAAGCCGAGAATGAACCCATGGAACCATCAAGAAGGTTATGTATGATCTGTATGGACGAAAAACCTTCCTCAGACAT
CTTCCGAGGAACCACTAACTGCACTCACGCCTATTGCACCGACTGTACTGTCCGTTACGTGGCAACTAAGATAAAAGAAA
ACGCATCGAGGATCAAATGCCCTGACGTGGAGTGCACGCGACTGATAGAGCCTTACACGTGTCGAGATCTAATCCCTAAG
GATGTATTCGACCGTTGGGAGAAAATCTTGTGCGAGTCTTTGATCTCCTCGTGGGACAAATTCTATTGTCCGTTCAAAGA
TTGTTCGGCGATGATGGTGAACAATGAAAATGGAGATGCTAACGTGACGCAGACGGAGTGTCGTTCTTGTCATAGACTGT
TCTGCGTGCAGTGTAAGGTGACATGGCATGCGGGGATTGGGTGTGATGAGTTTCAAAGATTTGGGAATACGAAGAAGAAG
AGTAGTGATGAAGACGATGCTTTGTTGATTCAGATGGCAAAAAATAAGCAGTGGAGAAGGTGTCCTAGTTGCAAATTCTA
TGTTGATAAAGTCGAGGGTTGTCAACATATAAAATGCAGGTGTGGATATCAGTTTTGCTATGGTTGTGGATCTGTGTGGA
GTTCTTCTCACGCATGCCAAATTCGTATCTAA