Details for Arabidopsis Locus AT3G14230

Position : Chr3 ( 5`- 4737146 .. 4739141 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14230

Protein [Map View]
MCGGAIISDFIPPPRSLRVTNEFIWPDLKNKVKASKKRSNKRSDFFDLDDDFEADFQGFKDDSAFDCEDDDDVFVNVKPF
VFTATTKPVASAFVSTGIYLVGSAYAKKTVESAEQAEKSSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTA
EEAARAYDAAARRIRGTKAKVNFPEEKNPSVVSQKRPSAKTNNLQKSVAKPNKSVTLVQQPTHLSQQYCNNSFDNSFGDM
SFMEEKPQMYNNQFGLTNSFDAGGNNGYQYFSSDQGSNSFDCSEFGWSDHGPKTPEISSMLVNNNEASFVEETNAAKKLK
PNSDESDDLMAYLDNALWDTPLEVEAMLGADAGAVTQEEENPVELWSLDEINFMLEGDF*

DNA
ATGTGTGGAGGAGCTATAATCTCCGATTTCATACCTCCGCCGAGGTCCCTCCGCGTCACTAACGAGTTTATCTGGCCGGA
TCTGAAAAACAAAGTGAAAGCTTCAAAGAAGAGATCGAATAAGCGATCCGATTTCTTCGATCTTGACGATGATTTCGAAG
CTGATTTCCAAGGGTTTAAGGATGACTCGGCTTTTGACTGCGAAGACGATGATGATGTCTTCGTCAATGTTAAGCCTTTC
GTCTTCACCGCAACTACTAAGCCCGTAGCTTCCGCTTTCGTCTCCACTGGTATATATTTGGTAGGTTCAGCATATGCCAA
GAAAACTGTAGAGTCCGCTGAGCAAGCTGAGAAATCTTCTAAGAGGAAGAGGAAGAATCAATACCGAGGGATTAGGCAGC
GTCCTTGGGGAAAATGGGCTGCGGAGATCCGTGATCCGAGAAAAGGCTCCCGAGAATGGCTTGGAACATTCGACACTGCT
GAGGAAGCAGCAAGAGCTTATGATGCTGCAGCACGCAGAATCCGTGGCACGAAAGCTAAGGTGAATTTTCCCGAGGAGAA
GAACCCTAGCGTCGTATCCCAGAAACGTCCTAGTGCTAAGACTAATAATCTTCAGAAATCAGTGGCTAAACCAAACAAAA
GCGTAACTTTGGTTCAGCAGCCAACACATCTGAGTCAGCAGTACTGCAACAACTCCTTTGACAACTCTTTTGGTGATATG
AGTTTCATGGAAGAGAAGCCTCAGATGTACAACAATCAGTTTGGGTTAACAAACTCGTTCGATGCTGGAGGTAACAATGG
ATACCAGTATTTCAGTTCCGATCAGGGCAGTAACTCCTTCGACTGTTCTGAGTTCGGGTGGAGTGATCACGGCCCTAAAA
CACCCGAGATCTCTTCAATGCTTGTCAATAACAACGAAGCATCATTTGTTGAAGAAACCAATGCAGCCAAGAAGCTCAAA
CCAAACTCTGATGAGTCAGACGATCTGATGGCATACCTTGACAACGCCTTGTGGGACACCCCACTAGAAGTGGAAGCCAT
GCTTGGCGCAGATGCTGGTGCTGTGACTCAGGAAGAGGAAAACCCAGTGGAGCTATGGAGCTTAGATGAGATCAATTTCA
TGCTGGAAGGAGACTTTTGA