Details for Arabidopsis Locus AT3G14210

Position : Chr3 ( 5`- 4729823 .. 4731803 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14210

Protein [Map View]
MADNLNLVSVLGVLLVLTIFHNPIIVYAGEGVPNVALFTFGDSYYDAGNKVFLSQRKDLPQTYWPYGKSRDYPNGKFSDG
HIVPDFIADFISIPNGVLPPVLKPGVDISRGVSFAVADASILGAPVESMTLNQQVVKFKNMKSNWNDSYIEKSLFMIYIG
TEDYLNFTKANPNADASAQQAFVTNVINRLKNDIKLLYSLGASKFVVQLLAPLGCLPIVRQEYKTGNECYELLNDLAKQH
NGKIGPMLNEFAKISTSPYGFQFTVFDFYNAVLRRIATGRSLNYRFFVTNTSCCGVGTHNAYGCGKGNVHSKLCEYQRSY
FFFDGRHNTEKAQEEMAHLLYGADPDVVQPMTVRELIVYPTGETMREYWEPNNLAIRRRPSRDFYLGLAAYY*

DNA
ATGGCAGACAATTTGAATTTGGTGAGTGTTCTGGGAGTCTTATTGGTATTAACCATCTTCCATAATCCGATCATCGTCTA
CGCCGGCGAGGGTGTTCCCAACGTAGCTTTGTTCACTTTCGGAGACTCTTACTACGACGCCGGAAACAAAGTGTTTCTCA
GCCAAAGGAAAGATCTTCCACAAACCTATTGGCCCTACGGAAAATCCCGCGACTACCCCAACGGCAAGTTTTCCGACGGC
CACATCGTCCCCGACTTCATCGCTGATTTCATCTCTATTCCGAATGGAGTACTCCCACCGGTGCTTAAACCGGGCGTTGA
TATTTCACGTGGAGTCAGCTTTGCCGTCGCCGATGCTTCTATTCTCGGAGCGCCGGTTGAATCTATGACACTAAATCAAC
AGGTGGTTAAATTCAAAAATATGAAATCGAATTGGAACGACAGCTACATCGAGAAATCACTGTTTATGATATACATTGGT
ACGGAAGATTATTTGAATTTCACCAAGGCCAACCCCAATGCAGACGCTTCTGCTCAGCAAGCTTTTGTCACTAACGTTAT
TAACCGATTAAAGAACGACATCAAATTGTTGTACTCTTTGGGAGCGAGTAAATTCGTGGTTCAATTGCTAGCACCATTGG
GATGCTTACCGATCGTGAGACAAGAATACAAAACCGGCAACGAGTGTTACGAGCTGCTCAATGATTTGGCCAAACAACAT
AACGGAAAAATCGGTCCAATGTTAAACGAATTTGCTAAAATTAGTACTAGCCCCTATGGTTTTCAGTTCACCGTCTTCGA
TTTCTACAACGCCGTTCTTCGTAGGATTGCGACAGGAAGAAGTCTTAACTACAGATTCTTCGTAACGAATACTTCGTGTT
GCGGTGTTGGGACACACAATGCATATGGTTGCGGAAAGGGAAACGTGCACTCGAAGCTATGTGAGTACCAAAGATCTTAC
TTCTTCTTCGATGGACGTCACAACACAGAGAAGGCTCAGGAGGAAATGGCTCATCTTCTATATGGAGCCGACCCTGACGT
GGTCCAGCCAATGACGGTCCGTGAGCTAATCGTCTACCCAACTGGAGAAACTATGCGTGAGTATTGGGAACCCAACAACT
TGGCTATCCGTCGTCGGCCGTCTCGTGACTTTTACTTGGGCCTCGCCGCCTATTATTAG