Details for Arabidopsis Locus AT3G14205

Position : Chr3 ( 5`- 4715707 .. 4720951 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G14205

Protein [Map View]
MAASERSIDKEVDMGSSFLQKFRLYETRSSFYMIGRDKNRTSWRVLKLDRTEPAEVNIYEDSTAYTEAECFETLRRIHEG
NRSSGGLKFVTTCYGIIGFIRFLGPYYMLIITKRKKLGEICGHTVYGVAKSKIITIPHASVLSNVAYSKDEKRYKRLLCT
VDLTKDFFFSYSYHIMHTLQRNLSNNVEGHTYYESMFVWNEYLTRRIRNNVKDCMWTVALVYGFFKQVKLSVSEKNFRLT
LISRRSRHYAGTRYLKRGVNEKGRVANDVETEQIVFEEAQDGNPGRISSVVQNRGSIPLFWSQETSRLNIKPDIILSPKD
PNFEATRLHFENLGRRYGNPIIILNLIKTREKRPRETILRAEFANAIRFINKGLSKEDRLRPLHWDLHKHSRKKGTNVLA
ILGRLATYALNLTSIFYCQLTPDLRGEGFQNQNPSTLENDDGECSTYDPPSKDETAPNLVVENGNDSKDAKEDQQKEVTM
LQKGVLRTNCIDCLDRTNVAQYAYGLVAFGRQLHALGLTESTNIDLDNPLAEDLMGIYETMGDTLALQYGGSAAHNKIFC
ERRGQWRAATQSQEFFRTLQRYYSNAYMDAEKQDAINVFLGYFQPQSDKPALWELGSDQHYNAARFLANSVPETSRSTMK
RSLSESSIISESSPAALGPVGRHGLAEKDEEVKGLSDSAPEISTSETAKIAASLSAPPPILEELGLDDILENDCFCCDGN
GEQCTCAAFDMDWVSSSGNSCEDESCGRATVVRSFETIPESRKIESEICVVETVGSNSRKGNKEEEEAISGIPEGYVRWV
MDEDGHFW*

DNA
ATGGCGGCGTCAGAGAGATCGATTGACAAAGAAGTCGACATGGGTTCTTCCTTTCTTCAAAAATTCAGGCTTTACGAGAC
CCGCTCGAGCTTCTATATGATTGGAAGAGATAAAAATCGAACGTCTTGGAGGGTCCTGAAGTTAGATAGGACAGAGCCAG
CAGAGGTCAATATCTACGAAGATTCAACGGCTTACACAGAAGCTGAATGCTTTGAAACTTTGAGAAGGATACACGAGGGA
AACAGATCATCTGGTGGTTTGAAATTTGTCACCACCTGCTACGGGATCATCGGATTCATAAGGTTCTTGGGACCTTATTA
CATGCTGATAATCACTAAAAGAAAGAAGCTTGGTGAAATTTGTGGGCACACTGTTTATGGTGTTGCGAAGAGCAAGATCA
TCACGATTCCACATGCCTCTGTGCTATCCAATGTGGCTTATTCTAAGGACGAGAAAAGGTACAAGAGGCTGCTCTGCACT
GTTGATCTCACAAAGGACTTCTTCTTCAGCTATTCCTATCACATCATGCATACACTTCAGAGGAATCTGTCTAACAATGT
GGAAGGACACACTTACTACGAATCGATGTTTGTCTGGAACGAATACTTAACTCGAAGGATTCGGAATAACGTGAAGGACT
GTATGTGGACAGTTGCCTTGGTATATGGATTTTTCAAACAGGTCAAACTATCAGTTTCTGAGAAGAACTTTAGATTGACT
CTAATTTCTCGCAGATCTCGGCATTATGCTGGTACAAGATATCTGAAACGTGGTGTAAACGAGAAAGGCAGGGTAGCTAA
TGATGTTGAGACAGAGCAGATTGTTTTCGAGGAAGCTCAAGATGGTAATCCCGGCCGAATAAGTTCTGTAGTTCAGAATC
GGGGTTCAATTCCTTTGTTCTGGTCTCAGGAGACCTCACGCTTGAATATCAAACCTGATATAATATTGTCACCGAAAGAC
CCCAACTTTGAGGCAACCAGACTGCATTTTGAAAATCTTGGAAGGAGATATGGGAATCCAATCATCATACTGAACTTGAT
AAAGACGCGTGAAAAGAGGCCTCGGGAGACTATTCTGCGTGCAGAGTTTGCAAATGCAATTAGATTTATTAATAAAGGGT
TAAGCAAAGAGGATCGTCTAAGGCCTCTTCACTGGGACTTGCATAAACACTCCAGAAAAAAAGGCACAAACGTGTTGGCA
ATTCTCGGCAGGTTGGCTACTTATGCTCTGAACTTGACCAGCATCTTCTACTGTCAATTAACTCCAGATCTTAGAGGAGA
AGGATTTCAGAACCAGAATCCATCCACCTTGGAGAACGACGATGGTGAATGTTCTACTTATGATCCACCCAGTAAAGATG
AAACTGCACCAAATTTGGTGGTGGAAAACGGTAATGATAGTAAGGATGCTAAGGAAGATCAGCAAAAGGAAGTTACCATG
CTGCAGAAAGGAGTCCTGAGGACCAATTGCATAGACTGTTTAGATCGCACCAATGTTGCTCAATATGCCTATGGGTTGGT
AGCATTTGGGCGTCAACTCCATGCTTTGGGATTGACAGAGTCTACTAATATTGATCTAGACAATCCCCTCGCTGAAGATT
TGATGGGAATTTATGAGACGATGGGAGATACACTTGCACTTCAGTATGGAGGATCCGCGGCACACAACAAGATATTTTGT
GAAAGGCGTGGTCAATGGAGAGCAGCGACTCAATCACAGGAATTCTTCAGAACTTTACAACGTTACTACAGTAACGCCTA
TATGGATGCCGAAAAGCAAGATGCAATTAACGTGTTCTTGGGATACTTTCAGCCACAATCAGATAAGCCAGCGCTATGGG
AATTGGGTTCTGATCAGCATTACAACGCAGCAAGATTTCTTGCCAATTCTGTACCAGAGACTTCAAGATCGACGATGAAA
CGATCTCTATCAGAAAGTAGCATCATTAGCGAGAGCAGTCCAGCCGCATTGGGACCAGTAGGTAGACATGGTTTAGCTGA
AAAAGATGAAGAAGTTAAAGGTCTTTCAGATTCAGCACCGGAGATCTCAACGTCTGAAACTGCCAAGATTGCTGCTAGTT
TGAGTGCTCCACCACCGATATTAGAGGAATTAGGTTTAGATGATATTCTTGAAAACGATTGCTTCTGCTGTGATGGGAAT
GGTGAGCAATGTACATGTGCAGCTTTTGATATGGATTGGGTATCTTCTTCAGGAAACTCTTGTGAAGATGAGAGTTGCGG
AAGAGCCACAGTGGTTAGATCCTTTGAAACCATCCCTGAAAGTAGAAAAATAGAGTCAGAAATTTGTGTTGTTGAAACAG
TTGGTTCCAACAGTAGAAAGGGAAATAAAGAAGAAGAAGAAGCCATTTCCGGGATTCCTGAAGGTTATGTGAGGTGGGTG
ATGGATGAAGACGGTCATTTCTGGTGA